Tested Applications
Positive IHC detected in | human prostate hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 6 publications below |
IHC | See 2 publications below |
Product Information
21165-1-AP targets HTR4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15226 Product name: Recombinant human HTR4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 301-388 aa of BC074755 Sequence: GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT Predict reactive species |
Full Name | 5-hydroxytryptamine (serotonin) receptor 4 |
Calculated Molecular Weight | 388 aa, 44 kDa |
GenBank Accession Number | BC074755 |
Gene Symbol | HTR4 |
Gene ID (NCBI) | 3360 |
RRID | AB_11182374 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q13639 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for HTR4 antibody 21165-1-AP | Download protocol |
IF protocol for HTR4 antibody 21165-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Biomed Pharmacother Enteromorpha and polysaccharides from enteromorpha ameliorate loperamide-induced constipation in mice. | ||
Nutrients Living, Heat-Killed Limosilactobacillus mucosae and Its Cell-Free Supernatant Differentially Regulate Colonic Serotonin Receptors and Immune Response in Experimental Colitis | ||
J Dairy Sci Synbiotic yogurt containing konjac mannan oligosaccharides and Bifidobacterium animalis ssp. lactis BB12 alleviates constipation in mice by modulating the stem cell factor (SCF)/c-Kit pathway and gut microbiota. | ||
Pharm Biol Prokinetic effects of Citrus reticulata and Citrus aurantium extract with/without Bupleurum chinense using multistress-induced delayed gastric emptying models | ||
J Nutr Limosilactobacillus mucosae and Lactobacillus amylovorus protect against experimental colitis via upregulation of colonic HTR4 and TGF-beta 2 |