• Featured Product
  • KD/KO Validated

HTRA2 Polyclonal antibody

HTRA2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 15775-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey and More (2)

Applications

WB, IHC, IF, IP, ELISA

EC:3.4.21.108, HtrA serine peptidase 2, OMI, Omi stress-regulated endoprotease, PARK13

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HAP1 cells, human heart tissue, mouse skeletal muscle tissue, Raji cells, MCF-7 cells, Jurkat cells, HEK-293 cells, SH-SY5Y cells, COS-7 cells, Neuro-2a cells
Positive IP detected inRaji cells
Positive IHC detected inhuman kidney tissue, human colon tissue, human thyroid tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15775-1-AP targets HTRA2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

Tested Reactivity human, mouse, rat, monkey
Cited Reactivityhuman, mouse, rat, monkey, chicken, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8455

Product name: Recombinant human HTRA2 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 133-458 aa of BC000096

Sequence: AAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE

Predict reactive species
Full Name HtrA serine peptidase 2
Calculated Molecular Weight 49 kDa
Observed Molecular Weight 36 kDa
GenBank Accession NumberBC000096
Gene Symbol HTRA2
Gene ID (NCBI) 27429
RRIDAB_2122835
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO43464
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HTRA2(High temperature requirement protein A2) is also named as OMI, PRSS25 and belongs to the peptidase S1B family. HTRA2 normally exists in the mitochondria, can cause MMP3 activation in the cytosol under a cell stress condition, which can ultimately lead to demise of dopaminergic neuronal cells(PMID: 22265821). It inhibits mitochondrial superoxide generation, stabilizes mitochondrial membrane potential, and prevents apoptosis at baseline and in response to extracellular inducers of mitochondrial stress(PMID: 18772386). This protein has 4 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IHC protocol for HTRA2 antibody 15775-1-APDownload protocol
IP protocol for HTRA2 antibody 15775-1-APDownload protocol
WB protocol for HTRA2 antibody 15775-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human

Cell Rep

TIM23 facilitates PINK1 activation by safeguarding against OMA1-mediated degradation in damaged mitochondria

Authors - Shiori Akabane
mouseWB

Int J Mol Sci

The Mechanism of Mitochondrial Injury in Alpha-1 Antitrypsin Deficiency Mediated Liver Disease.

Authors - Nazli Khodayari

Mol Neurobiol

Mitochondrial Proteome Changes Correlating with β-Amyloid Accumulation.

Authors - Katalin Völgyi
humanWB

Hum Mol Genet

Multi-OMICS study of a CHCHD10 variant causing ALS demonstrates metabolic rewiring and activation of endoplasmic reticulum and mitochondrial unfolded protein responses.

Authors - Isabella R Straub
humanWB

Cancer Sci

Establishment of MAGEC2-knockout cells and functional investigation of MAGEC2 in tumor cells.

Authors - Jingjing Wang
humanIHC

Cancer Biomark

Role of Smac, survivin, XIAP, and Omi/HtrA2 proteins in determining the chemotherapeutic response of patients with cervical cancer treated with neoadjuvant chemotherapy

Authors - Tianyi Ye

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Ziwei (Verified Customer) (01-04-2026)

works as it should be.

  • Applications: Western Blot
FH

Ziwei (Verified Customer) (12-14-2025)

This antibody shows high specificity and sensitivity in Western blot applications.

  • Applications: Western Blot
FH

Monifa (Verified Customer) (08-31-2025)

This antibody worked well for detecting HTRA2 levels in these cells. I do have to load >100ug of lysate as these cells are suspension and slow growing. But a 1:1000 dilution in 1% BSA, overnight 4C gave me good signal of this protein in whole cell lysates as well as in crude mitochondria isolated fractions.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HL60
FH

Abigail (Verified Customer) (04-04-2024)

Reproducibly generates a clean, strong signal at ~36 kDa! Highly recommend!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T
Loading...
||
New chat

Able

正在加载,请稍候...