Use Able AI chat for product recommendations

IDH1 Polyclonal antibody

IDH1 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 23309-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

Cytosolic NADP-isocitrate dehydrogenase, EC:1.1.1.42, IDCD, IDH, IDH 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, mouse liver tissue
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 3 publications below

Product Information

23309-1-AP targets IDH1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19749

Product name: Recombinant human IDH1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 341-414 aa of BC012846

Sequence: AHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL

Predict reactive species
Full Name isocitrate dehydrogenase 1 (NADP+), soluble
Calculated Molecular Weight 414 aa, 47 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberBC012846
Gene Symbol IDH1
Gene ID (NCBI) 3417
RRIDAB_11232028
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75874
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IDH1, also named as PICD and IDP, belongs to the isocitrate and isopropylmalate dehydrogenases family. It is a common feature of a major subset of primary human brain cancers. Its subunit structure is homodimer(PMID:15173171).IDH1 mutation is always heterozygotic and IDH1 functions as a dimer, theoretically there will be 25% each wild type and mutant homo-dimers and 50% hetero-dimers present in the tumor cells(PMID:21079649 ). This antibody is specific to IDH1.

Protocols

Product Specific Protocols
FC protocol for IDH1 antibody 23309-1-APDownload protocol
IHC protocol for IDH1 antibody 23309-1-APDownload protocol
WB protocol for IDH1 antibody 23309-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Cell Biol

Identification of distinct nanoparticles and subsets of extracellular vesicles by asymmetric flow field-flow fractionation.

Authors - Haiying Zhang
humanWB

Med Oncol

Isocitrate dehydrogenase gene mutations and 2-hydroxyglutarate accumulation in esophageal squamous cell carcinoma.

Authors - Keisuke Miyake
humanWB

Antioxidants (Basel)

Progranulin Deficiency Induces Mitochondrial Dysfunction in Frontotemporal Lobar Degeneration with TDP-43 Inclusions

Authors - Guiomar Rodríguez-Periñán
Loading...
||
New chat

Able

正在加载,请稍候...