Filter: AllWBIPIHC

WB analysis using 15932-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 15932-1-AP (IDH2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
WB analysis of HEK-293 using 15932-1-AP
WB result of IDH2 antibody (15932-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IDH2 transfected HEK-293 cells.
WB analysis of mouse heart using 15932-1-AP
mouse heart tissue were subjected to SDS PAGE followed by western blot with 15932-1-AP (IDH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse skeletal muscle using 15932-1-AP
mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15932-1-AP (IDH2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
WB analysis of NIH/3T3 using 15932-1-AP
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 15932-1-AP (IDH2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
WB analysis of Jurkat using 15932-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 15932-1-AP (IDH2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
WB analysis of Jurkat using 15932-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 15932-1-AP (IDH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse brain using 15932-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 15932-1-AP (IDH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse liver using 15932-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 15932-1-AP (IDH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of rat liver using 15932-1-AP
rat liver tissue were subjected to SDS PAGE followed by western blot with 15932-1-AP (IDH2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 15932-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 15932-1-AP (IDH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of HEK-293 using 15932-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 15932-1-AP (IDH2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
WB analysis of SH-SY5Y using 15932-1-AP
SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 15932-1-AP (IDH2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
IP experiment of mouse brain using 15932-1-AP
IP result of anti-IDH2 (IP:15932-1-AP, 3ug; Detection:15932-1-AP 1:1000) with mouse brain tissue lysate 6000ug.
IHC staining of human colon cancer using 15932-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15932-1-AP (IDH2 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human colon cancer using 15932-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15932-1-AP (IDH2 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse kidney using 15932-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 15932-1-AP (IDH2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse kidney using 15932-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 15932-1-AP (IDH2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human colon cancer using 15932-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15932-1-AP (IDH2 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human colon cancer using 15932-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15932-1-AP (IDH2 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Featured Product
KD/KO Validated

IDH2 Polyclonal antibody

Name: IDH2 Polyclonal antibody
Brand: Proteintech
SKU: 15932-1-AP
Rating: 4.00 (1 reviews)

IDH2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 15932-1-AP

Publications(56)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

EC:1.1.1.42, ICD M, ICD-M, IDH 2, IDHM

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (56)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293 cells, Jurkat cells, HeLa cells, mouse heart tissue, mouse skeletal muscle tissue, mouse liver tissue, rat liver tissue, NIH/3T3 cells, SH-SY5Y cells, mouse brain tissue, HepG2 cells, K-562 cells
Positive IP detected in	mouse brain tissue
Positive IHC detected in	human colon cancer tissue, mouse kidney tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:3000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 4 publications below
WB	See 51 publications below
IHC	See 5 publications below
IF	See 1 publications below
IP	See 2 publications below
CoIP	See 1 publications below

Product Information

15932-1-AP targets IDH2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, pig, chicken
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag8779 Product name: Recombinant human IDH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 104-452 aa of BC009244 Sequence: TQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ Predict reactive species
Full Name	isocitrate dehydrogenase 2 (NADP+), mitochondrial
Calculated Molecular Weight	452 aa, 51 kDa
Observed Molecular Weight	41-47 kDa
GenBank Accession Number	BC009244
Gene Symbol	IDH2
Gene ID (NCBI)	3418
RRID	AB_2264612
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P48735
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH1 and IDH2 mutations could also contribute to tumorigenesis and cancer progression through increased mutagenesis. IDH2 contains an N-terminal mitochondrial addressing sequence and hence is imported to the mitochondrial matrix, although localization to nuclei has also been reported. Moreover, IDH2, like ~20% of other mitochondrial enzymes, is acetylated at lysines, which inactivates the enzymatic activity.

Protocols

Product Specific Protocols
IHC protocol for IDH2 antibody 15932-1-AP	Download protocol
IP protocol for IDH2 antibody 15932-1-AP	Download protocol
WB protocol for IDH2 antibody 15932-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Cell Res Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. Authors - Shaojun Zhang View Article
human	WB	Adv Sci (Weinh) SUCLG2 Regulates Mitochondrial Dysfunction through Succinylation in Lung Adenocarcinoma Authors - Qifan Hu View Article
human	WB	Nat Commun Lin28/let-7 axis regulates aerobic glycolysis and cancer progression via PDK1. Authors - Xiaoyu Ma View Article
mouse	WB	Aging Dis Dietary Salt Disrupts Tricarboxylic Acid Cycle and Induces Tau Hyperphosphorylation and Synapse Dysfunction during Aging Authors - Minghao Yuan View Article
pig	WB	Sci Total Environ Protein lysine acetylation played an important role in NH3-induced AEC2 damage and pulmonary fibrosis in piglets Authors - Xiaotong Wang View Article
human	WB,IHC	Mol Syst Biol STAT3-dependent analysis reveals PDK4 as independent predictor of recurrence in prostate cancer. Authors - Monika Oberhuber View Article