Tested Applications
| Positive WB detected in | HEK-293 cells, mouse kidney tissue, mouse liver tissue, rat kidney tissue, rat liver tissue, DU 145 cells, Jurkat cells, mouse brain tissue |
| Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IF | See 1 publications below |
Product Information
23254-1-AP targets IDH2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19748 Product name: Recombinant human IDH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 394-452 aa of BC009244 Sequence: FAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ Predict reactive species |
| Full Name | isocitrate dehydrogenase 2 (NADP+), mitochondrial |
| Calculated Molecular Weight | 452 aa, 51 kDa |
| Observed Molecular Weight | 41-47 kDa |
| GenBank Accession Number | BC009244 |
| Gene Symbol | IDH2 |
| Gene ID (NCBI) | 3418 |
| RRID | AB_2879241 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48735 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH1 and IDH2 mutations could also contribute to tumorigenesis and cancer progression through increased mutagenesis. IDH2 contains an N-terminal mitochondrial addressing sequence and hence is imported to the mitochondrial matrix, although localization to nuclei has also been reported. Moreover, IDH2, like ~20% of other mitochondrial enzymes, is acetylated at lysines, which inactivates the enzymatic activity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IDH2 antibody 23254-1-AP | Download protocol |
| IHC protocol for IDH2 antibody 23254-1-AP | Download protocol |
| WB protocol for IDH2 antibody 23254-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Nuclear translocation of mitochondrial dehydrogenases as an adaptive cardioprotective mechanism | ||
Sci Transl Med Aberrant methylmalonylation underlies methylmalonic acidemia and is attenuated by an engineered sirtuin |
