Product Information
24811-1-AP targets IFNA6 in ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20623 Product name: Recombinant human IFNA6 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 97-144 aa of BC098357 Sequence: SVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVR Predict reactive species |
Full Name | interferon, alpha 6 |
Calculated Molecular Weight | 189 aa, 22 kDa |
GenBank Accession Number | BC098357 |
Gene Symbol | IFNA6 |
Gene ID (NCBI) | 3443 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P05013 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |