Tested Applications
| Positive WB detected in | HEK-293 cells, NIH/3T3 cell, MDCK cells, mouse thymus tissue |
| Positive IP detected in | knockout cells and WT cells, HEK-293 cells |
| Positive IHC detected in | mouse heart tissue, human pancreas tissue, rat heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | hTERT-RPE1 cells, MDCK cells, C2C12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 51 publications below |
| WB | See 163 publications below |
| IHC | See 8 publications below |
| IF | See 267 publications below |
| IP | See 4 publications below |
| CoIP | See 1 publications below |
Product Information
13967-1-AP targets IFT88 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.
| Tested Reactivity | human, mouse, rat, canine |
| Cited Reactivity | human, mouse, rat, pig, canine, chicken, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4980 Product name: Recombinant human IFT88 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 532-833 aa of BC030776 Sequence: NIGLTYEKLNRLDEALDCFLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDRGGDKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE Predict reactive species |
| Full Name | intraflagellar transport 88 homolog (Chlamydomonas) |
| Calculated Molecular Weight | 94 kDa |
| Observed Molecular Weight | 94 kDa |
| GenBank Accession Number | BC030776 |
| Gene Symbol | IFT88 |
| Gene ID (NCBI) | 8100 |
| RRID | AB_2121979 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13099 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium and has been shown to be essential for the assembly and maintenance of cilia and flagella in many organisms. IFT88 (intraflagellar transport protein 88; also known as TG737 or TTC10) is a component of IFT particles and required for cilium biogenesis. Defects in IFT88/Tg737 lead to polycystic kidney disease (11062270). IFT88 localizes to spindle poles during mitosis and is required for spindle orientation in mitosis (21441926). This antibody was raised against the C-terminal region of human IFT88 and can detect the endogenous level of IFT88.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IFT88 antibody 13967-1-AP | Download protocol |
| IHC protocol for IFT88 antibody 13967-1-AP | Download protocol |
| IP protocol for IFT88 antibody 13967-1-AP | Download protocol |
| WB protocol for IFT88 antibody 13967-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Science Apical abscission alters cell polarity and dismantles the primary cilium during neurogenesis. | ||
Nat Genet Mutations in PLK4, encoding a master regulator of centriole biogenesis, cause microcephaly, growth failure and retinopathy. | ||
Nat Genet A transition zone complex regulates mammalian ciliogenesis and ciliary membrane composition. | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Lola (Verified Customer) (10-23-2025) | This antibody works well for immunofluorescence and expansion microscopy.
![]() |
FH Lucia (Verified Customer) (09-18-2025) | Antigen retrieval citrate buffer with pressure cooker, block 1h RT, Primary antibody 1:200 4ºC overnight, secondary antibody 1:500 2h RT.
|
FH Parijat (Verified Customer) (04-08-2024) | Good Antibody for IF.
|
FH Serhiy (Verified Customer) (01-04-2023) | This antibody detects Ift88 in ciliary axonemes of immunofluorescently stained IMCD3 cells (atteched image: red Ift88; green - gamma-tubulin) and mouse fibroblasts. We also tried to detect endogenous Ift88 in NIH3T3 cells by western blots and found that antibody detects several non-specific bands in addition to apparently specific one between the 75-100 kDa markers.
![]() |
FH Charlotte (Verified Customer) (07-26-2022) | We have revealed IFT88 after stripping a couple of times. The signal remains nice and the unspecific bands might be due to lower stripping efficiency
![]() |
FH Stephen (Verified Customer) (02-08-2022) | works well in RPE cells stains Primary cilia seen by co-staining with Ac-Tubulin
![]() |
FH Boyan (Verified Customer) (01-31-2019) | Excellent. Works quite well both in WB and IF.
|





























