• Featured Product
  • KD/KO Validated

IKKB Polyclonal antibody

IKKB Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 15649-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF, IP, CoIP, ELISA

IKBKB, EC:2.7.11.1, EC:2.7.11.10, I kappa B kinase 2, I kappa B kinase beta

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, mouse brain tissue, rat brain tissue, rat lung tissue
Positive IP detected inJurkat cells
Positive IHC detected inhuman liver cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15649-1-AP targets IKKB in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8191

Product name: Recombinant human IKBKB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-256 aa of BC006231

Sequence: MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVAHSCNPSTLGGRGRWIS

Predict reactive species
Full Name inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
Calculated Molecular Weight756aa,81 kDa; 256aa,29 kDa
Observed Molecular Weight 80 kDa, 86 kDa, 87 and 29 kDa
GenBank Accession NumberBC006231
Gene Symbol IKBKB
Gene ID (NCBI) 3551
RRIDAB_2122307
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14920
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IKBKB, also named as IKKB, IKK2, NFKBIKB and IKK-B, belongs to the protein kinase superfamily, Ser/Thr protein kinase family and I-kappa-B kinase subfamily. IKBKB is a Serine kinase that plays an essential role in the NF-kappa-B signaling pathway. It acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on 2 critical serine residues. In addition to the NF-kappa-B inhibitors, IKBKB phosphorylates several other components of the signaling pathway including NEMO/IKBKG, NF-kappa-B subunits RELA and NFKB1, as well as IKK-related kinases TBK1 and IKBKE. It also phosphorylates other substrates including NCOA3, BCL10 and IRS1. Within the nucleus, IKBKB acts as an adapter protein for NFKBIA degradation in UV-induced NF-kappa-B activation. This antibody can identify 4 isoform of IKBKB with the molecular weight of 80, 86, 87 and 29 kDa.

Protocols

Product Specific Protocols
IHC protocol for IKKB antibody 15649-1-APDownload protocol
IP protocol for IKKB antibody 15649-1-APDownload protocol
WB protocol for IKKB antibody 15649-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nat Commun

Hypothalamic SLC7A14 accounts for aging-reduced lipolysis in white adipose tissue of male mice

Authors - Xiaoxue Jiang
mouseWB

Adv Sci (Weinh)

Sirtuin 5-Mediated Desuccinylation of ALDH2 Alleviates Mitochondrial Oxidative Stress Following Acetaminophen-Induced Acute Liver Injury

Authors - Qiwen Yu
mouseWB

Drug Des Devel Ther

Sichen Formula Ameliorates Lipopolysaccharide-Induced Acute Lung Injury via Blocking the TLR4 Signaling Pathways

Authors - Li-Shan Yan
humanIF

Cell Death Discov

tRNA-derived fragment TRF365 regulates the metabolism of anterior cruciate ligament cells by targeting IKBKB.

Authors - Dianbo Long
ratWB

Redox Biol

Cardioprotection of CAPE-oNO2 against myocardial ischemia/reperfusion induced ROS generation via regulating the SIRT1/eNOS/NF-κB pathway in vivo and in vitro.

Authors - Dejuan Li

Br J Pharmacol

PMID: 28963856

Authors - Xiao Han

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Eugenia (Verified Customer) (03-16-2022)

Antibody worked well with specific band although a couple of non-specific bands also appeared.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: A549 lung cancer cell line
Loading...
||
New chat

Able

正在加载,请稍候...