Tested Applications
| Positive IHC detected in | human tonsillitis tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
60270-1-Ig targets IL-28A in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Affinity | KD=1.77 x 109M KOff=4.10 x 10-5M KOn=2.31 x 104M |
| Immunogen |
CatNo: Ag18525 Product name: Recombinant human IL-28A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-91 aa of BC113583 Sequence: TVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQV Predict reactive species |
| Full Name | interleukin 28A (interferon, lambda 2) |
| Calculated Molecular Weight | 200 aa, 22 kDa |
| GenBank Accession Number | BC113583 |
| Gene Symbol | IL-28A |
| Gene ID (NCBI) | 282616 |
| RRID | AB_2881390 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q8IZJ0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IL28A, also named as IFNL2 and ZCYT020, is a cytokine with immunomodulatory activity. It up-regulates MHC class I antigen expression. IL28A is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1. The ligand/receptor complex seems to signal through the Jak-STAT pathway. It plays a significant role in the antiviral immune defense in the intestinal epithelium.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-28A antibody 60270-1-Ig | Download protocol |
| IHC protocol for IL-28A antibody 60270-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











