IL-28A Monoclonal antibody

IL-28A Monoclonal Antibody for IHC, IF-P, ELISA

Cat No. 60270-1-Ig

Clone No.3B4A1

Publications(1)

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

IL28A, Cytokine Zcyto20, IFN lambda 2, IFNL2, IFN-lambda-2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite®594

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHCIF-P

IHC staining of human tonsillitis using 60270-1-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60270-1-Ig (IL-28A antibody at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 60270-1-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60270-1-Ig (IL-28A antibody at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human small intestine using 60270-1-Ig
Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 60270-1-Ig (IL-28A antibody at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human small intestine using 60270-1-Ig
Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 60270-1-Ig (IL-28A antibody at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human tonsillitis using 60270-1-Ig
Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using IL-28A antibody (60270-1-Ig, Clone: 3B4A1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human tonsillitis using 60270-1-Ig
Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using IL-28A antibody (60270-1-Ig, Clone: 3B4A1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in	human tonsillitis tissue, human small intestine tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	human tonsillitis tissue

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)-P	IF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60270-1-Ig targets IL-28A in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	mouse
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Affinity	K_D=1.77 x 10⁹M K_Off=4.10 x 10^-5M K_On=2.31 x 10⁴M
Immunogen	CatNo: Ag18525 Product name: Recombinant human IL-28A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-91 aa of BC113583 Sequence: TVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQV Predict reactive species
Full Name	interleukin 28A (interferon, lambda 2)
Calculated Molecular Weight	200 aa, 22 kDa
GenBank Accession Number	BC113583
Gene Symbol	IL-28A
Gene ID (NCBI)	282616
RRID	AB_2881390
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q8IZJ0
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL28A, also named as IFNL2 and ZCYT020, is a cytokine with immunomodulatory activity. It up-regulates MHC class I antigen expression. IL28A is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1. The ligand/receptor complex seems to signal through the Jak-STAT pathway. It plays a significant role in the antiviral immune defense in the intestinal epithelium.

Protocols

Product Specific Protocols
IF protocol for IL-28A antibody 60270-1-Ig	Download protocol
IHC protocol for IL-28A antibody 60270-1-Ig	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
mouse	WB	Biomaterials Biomimetic nanoplatforms for combined DDR2 inhibition and photothermal therapy in dense breast cancer treatment Authors - Yan Chen View Article