Tested Applications
| Positive WB detected in | LPS and Protein transport inhibitor treated HUVEC cells |
| Positive IP detected in | LPS and Protein transport inhibitor treated HUVEC cells |
| Positive IF/ICC detected in | LPS and Brefeldin A treated HUVEC cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21865-1-AP targets IL-6 in WB, IHC, IF/ICC, FC, IP, CoIP, Neutralization, ELISA, Cell treatment applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, rabbit, canine, monkey, chicken, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10565 Product name: Recombinant human IL-6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC015511 Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Predict reactive species |
| Full Name | interleukin 6 (interferon, beta 2) |
| Calculated Molecular Weight | 212 aa, 24 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC015511 |
| Gene Symbol | IL6 |
| Gene ID (NCBI) | 3569 |
| ENSEMBL Gene ID | ENSG00000136244 |
| RRID | AB_11142677 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05231 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. IL-6 plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. IL-6 is also considered a myokine, a cytokine produced from muscle, and is elevated in response to muscle contraction. IL-6 has been shown to interact with interleukin-6 receptor and glycoprotein 130. Additionally, IL-6 is involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-6 antibody 21865-1-AP | Download protocol |
| IP protocol for IL-6 antibody 21865-1-AP | Download protocol |
| WB protocol for IL-6 antibody 21865-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IL-6 Polyclonal antibody (Cat# 21865-1-AP) has accumulated 986 citations across high-impact journals including Cell, Cancer Cell, Nature Communications, Nature Immunology, Nature Biotechnology, Nature Aging, Advanced Science, Bioactive Materials, Theranostics, and Phytomedicine. Research fields span oncology, immunology and inflammation, fibrosis, neuroinflammation, senescence and aging, ferroptosis, cardiovascular disease, osteoarthritis, wound healing and biomaterials, gut microbiota, and nanomedicine.
| Species | Application | Title |
|---|---|---|
Cancer Cell Macropinocytosis maintains CAF subtype identity under metabolic stress in pancreatic cancer | ||
Cancer Cell Cathepsin C promotes breast cancer lung metastasis by modulating neutrophil infiltration and neutrophil extracellular trap formation. | ||
J Hematol Oncol Ovatodiolide suppresses colon tumorigenesis and prevents polarization of M2 tumor-associated macrophages through YAP oncogenic pathways. | ||
J Hematol Oncol FFAR2 expressing myeloid-derived suppressor cells drive cancer immunoevasion | ||
Nat Biotechnol Magnify is a universal molecular anchoring strategy for expansion microscopy |
Reviews
What customers say
Both reviewers used this antibody for Western Blot at a 1:1000 dilution. One user (U2OS cells) gave it 5 stars and noted that the lowest band corresponds to IL-6. The other user (mouse samples) rated it 4 stars with no additional comments. Overall, the antibody received positive feedback for WB performance across different species and cell types.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Udesh (Verified Customer) (04-19-2023) | Lowest most band corresponds to IL-6
 |
Elizabeth (Verified Customer) (12-03-2018) |
|
