Use Able AI chat for product recommendations

IL-9 Monoclonal antibody

IL-9 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66144-1-Ig
Clone No.1F3A11

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (2)

Applications

WB, IHC, IF-P, ELISA

IL9, 1F3A11, IL 9, interleukin 9, interleukin9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRecombinant protein, Recombinant protein protein
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)-PIF-P : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66144-1-Ig targets IL-9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21435

Product name: Recombinant human IL-9 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 31-144 aa of BC066284

Sequence: NFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Predict reactive species
Full Name interleukin 9
Calculated Molecular Weight 144 aa, 16 kDa
Observed Molecular Weight 19 kDa
GenBank Accession NumberBC066284
Gene Symbol IL9
Gene ID (NCBI) 3578
RRIDAB_2881541
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15248
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin 9 (IL-9) is a γc-family cytokine that is highly produced by T-helper 9 (Th9) cells. IL-9 could promote the survival and activation of various cellular targets, including mast cells, B cells, T cells, and structural cells. Its expression is considered a hallmark of Th2-lineage cells. Primarily studied in Th2-type immunity, IL-9 was shown to be involved in asthma, allergy, and host defense against helminth infections. IL-9 also stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.(PMID: 38864109; PMID: 29038115; PMID: 9505195; PMID: 29703631)

Protocols

Product Specific Protocols
IF protocol for IL-9 antibody 66144-1-IgDownload protocol
IHC protocol for IL-9 antibody 66144-1-IgDownload protocol
WB protocol for IL-9 antibody 66144-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
rat,humanWB

Int J Biol Macromol

EgG1Y162 protein from Echinococcus granulosus modulates the immune functions of mouse splenic lymphocytes and regulates Th9 cells

Authors - Xia Chen
humanWB

FEBS Open Bio

Bach2 overexpression represses Th9 cell differentiation by suppressing IRF4 expression in systemic lupus erythematosus.

Authors - Yujun Sheng
humanIHC

Clin Cosmet Investig Dermatol

Higher IL-9 Level is Associated with Psoriasis Vulgaris Complicated by Metabolic Syndrome

Authors - Liang Yan
humanIHC

J Trop Med

A Series of 35 Cutaneous Infections Caused by Mycobacterium marinum in Han Chinese Population

Authors - Wenjie Chen
humanIF

Cancer Immunol Immunother

Impact of innate lymphoid cell type 2 in chronic lymphocytic leukemia on the function of treg and CD8+ T cells through IL-9

Authors - Ruixue Yang

Tissue Cell

Adiponectin attenuates atherosclerosis via macrophage polarization-mediated T Cell exhaustion by modulating the NF-κB p65/PI3K/Akt signaling pathway

Authors - Man Qin
Loading...
||
New chat

Able

正在加载,请稍候...