INSR/CD220 Polyclonal antibody

INSR/CD220 Polyclonal Antibody for WB, IP, ELISA
Cat No. 20433-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (6)

Applications

WB, IHC, IF, IP, CoIP, Dot blot, ELISA

INSR, CD220, EC:2.7.10.1, HHF5, insulin receptor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, MCF-7 cells, HT-1080 cells, HeLa cells
Positive IP detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20433-1-AP targets INSR/CD220 in WB, IHC, IF, IP, CoIP, Dot blot, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, pig, zebrafish, bovine, fish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13922

Product name: Recombinant human INSR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 968-1370 aa of BC117172

Sequence: RKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS

Predict reactive species
Full Name INSR
Calculated Molecular Weight 1382 aa, 156 kDa
Observed Molecular Weight 190 kDa, 135 kDa, 95 kDa
GenBank Accession NumberBC117172
Gene Symbol INSR
Gene ID (NCBI) 3643
RRIDAB_10646469
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP06213
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The biological effects of INS are mediated by a membrane-spanning cell surface receptor that has been shown to consist of disulfide-linked alpha-subunits (135 kDa) and beta-subunits (95 kDa) that are cleaved products of a common precursor. The binding of INS to the receptor extracellular domain results in intracellular activation of a tyrosine-specific kinase activity and the generation of signals that determine the cellular response (PMID: 2369896). This antibody raised against 980-1382aa of human INS receptor can recognize full-length INS receptor precursor and INS receptor beta subunit.

Protocols

Product Specific Protocols
IP protocol for INSR/CD220 antibody 20433-1-APDownload protocol
WB protocol for INSR/CD220 antibody 20433-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseDot blot

Environ Health Perspect

Effects of Chronic Secondhand Smoke (SHS) Exposure on Cognitive Performance and Metabolic Pathways in the Hippocampus of Wild-Type and Human Tau Mice.

Authors - Jacob Raber
mouseWB

Int J Biol Macromol

Lycium barbarum polysaccharide mitigates high-fat-diet-induced skeletal muscle atrophy by promoting AMPK/PINK1/Parkin-mediated mitophagy

Authors - Yanru Ren
ratWB

Food Funct

l-Theanine regulates glucose, lipid, and protein metabolism via insulin and AMP-activated protein kinase signaling pathways

Authors - Ling Lin
humanWB

Br J Surg

MiR-128 regulation of glucose metabolism and cell proliferation in triple-negative breast cancer.

Authors - M Xiao
humanWB

FASEB J

Angptl7 promotes insulin resistance and type 2 diabetes mellitus by multiple mechanisms including SOCS3-mediated IRS1 degradation.

Authors - Tong Xu
mouseWB,IHC

Sci Rep

NaoXinTong Capsules inhibit the development of diabetic nephropathy in db/db mice.

Authors - Shu Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Mi (Verified Customer) (05-29-2023)

It works well in human white adipocytes, we get strong signals

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: adipocytes
FH

Chiara (Verified Customer) (10-04-2021)

Works well but three bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: mesenchymal Stem cell
FH

Boyan (Verified Customer) (06-06-2021)

This antibody recognized a band at ~ 180 kd only, which is sensitive to PNGaseF, but not EndoH, treatment. The size is much bigger than an expected InsR band. Importantly, stripping the membrane and re-blot with another InsR antibody from a different brand could detect the protein at the expected MW. These results suggest this InsR antibody is detecting something other than InsR.

  • Applications: Western Blot
Loading...
||
New chat

Able

正在加载,请稍候...