IP6K2 Polyclonal antibody

IP6K2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 13155-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

IHPK2, InsP6 kinase 2, IP6K2, P(i) uptake stimulator, PiUS

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman adrenal gland tissue, human heart tissue, K-562 cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3600
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13155-1-AP targets IP6K2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3786

Product name: Recombinant human IP6K2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC019694

Sequence: MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYTVEKKGNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE

Predict reactive species
Full Name inositol hexakisphosphate kinase 2
Calculated Molecular Weight 426 aa, 49 kDa
Observed Molecular Weight 49 kDa
GenBank Accession NumberBC019694
Gene Symbol IP6K2
Gene ID (NCBI) 51447
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UHH9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IP6K2(Inositol hexakisphosphate kinase 2) is also named as IHPK2, PiUS and belongs to the inositol phosphokinase (IPK) family. It converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5) and and mediates apoptotic cell death via its translocation from the nucleus to the cytoplasm(PMID:21652713). IP6K2 regulates TP53 and protein kinase AKT signaling, and its aberrant increase in cells has been implicated in apoptosis and INS resistance(PMID:21262846). It has 6 isoforms produced by alternative splicing. This antibody recognizes the others except the 8 kDa isoform of IP6K2.

Loading...
||
New chat Able
正在加载,请稍候...