Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

IQGAP1 Polyclonal antibody

IQGAP1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 22167-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), IP, RIP, ELISA

HUMORFA01, KIAA0051, p195, Ras GTPase-activating-like protein IQGAP1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, SGC-7901 cells, HepG2 cells, NIH/3T3 cells
Positive IP detected inHeLa cells
Positive IHC detected inmouse kidney tissue, human breast cancer tissue, human colon tissue, mouse lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells, HeLa cells, A549 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22167-1-AP targets IQGAP1 in WB, IHC, IF/ICC, FC (Intra), IP, RIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17821

Product name: Recombinant human IQGAP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 478-827 aa of BC151834

Sequence: QLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRD

Predict reactive species
Full Name IQ motif containing GTPase activating protein 1
Calculated Molecular Weight 189 kDa
Observed Molecular Weight 190-195 kDa
GenBank Accession NumberBC151834
Gene Symbol IQGAP1
Gene ID (NCBI) 8826
ENSEMBL Gene IDENSG00000140575
RRIDAB_10949193
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP46940
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IQGAP1 is a member of a family of scaffolding proteins that interact with signaling and structural molecules. It localizes to sites of cell-cell contact in epithelial cells and regulates distinct cellular processes including cell adhesion, cell migration, extracellular signals through interacting with numerous protein. Multiple studies have shown that IQGAP1 is up-regulated in many human malignancies, such as lung cancer, ovarian cancer, colon cancer, breast cancer, melanoma and HCC. And IQGAP1 plays a critical role in cancer cell invasion.

Protocols

Product Specific Protocols
FC protocol for IQGAP1 antibody 22167-1-APDownload protocol
IF protocol for IQGAP1 antibody 22167-1-APDownload protocol
IHC protocol for IQGAP1 antibody 22167-1-APDownload protocol
IP protocol for IQGAP1 antibody 22167-1-APDownload protocol
WB protocol for IQGAP1 antibody 22167-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Nat Commun

Targeting NRAS via miR-1304-5p or farnesyltransferase inhibition confers sensitivity to ALK inhibitors in ALK-mutant neuroblastoma

Authors - Perla Pucci
humanWB,IP

Cancer Commun (Lond)

Glutamine metabolic microenvironment drives M2 macrophage polarization to mediate trastuzumab resistance in HER2-positive gastric cancer

Authors - Xingbin Hu
  • KD Validated
humanWB

Theranostics

Anti-allergic drug azelastine suppresses colon tumorigenesis by directly targeting ARF1 to inhibit IQGAP1-ERK-Drp1-mediated mitochondrial fission.

Authors - Hui-Fang Hu
WB

Oncogene

The scaffold protein IQGAP1 links heat-induced stress signals to alternative splicing regulation in gastric cancer cells.

Authors - Andrada-Maria Birladeanu
  • KO Validated
humanWB

Oncotarget

Diet-induced hypercholesterolemia promotes androgen-independent prostate cancer metastasis via IQGAP1 and caveolin-1.

Authors - Hyeongsun Moon
humanWB,IF

Front Cell Infect Microbiol

IQGAP1 Mediates Hcp1-Promoted Escherichia coli Meningitis by Stimulating the MAPK Pathway.

Authors - Mingna Zhao
  • KD Validated

Reviews

    4.6 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


JIN-FENG (Verified Customer) (10-01-2025)

I used the IQGAP1 antibody to screen my CRISPR-generated cells. It produced a highly specific signal, which gave me confidence throughout the screening process.

  • Applications: Western Blot, Cell culture
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293 cell line
IQGAP1 Antibody Western Blot,Cell culture validation (1:1000 dilution) in HEK293 cell line (Cat no:22167-1-AP)

Joleen (Verified Customer) (06-16-2019)

The antibody recognizes IQGAP (top band) but also another band at a lower molecular weight.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1k
  • Cell Tissue Type: MDCK GII
IQGAP1 Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:22167-1-AP)

Chun-Chih (Verified Customer) (01-31-2019)

Works well in IP at recommended conc. Clear and strong band, 1mg protein lysate per condition.

  • Applications: Immunoprecipitation,
  • Cell Tissue Type: Human breast cancer cells
Loading...
||
New chat

Able

正在加载,请稍候...