Use Able AI chat for product recommendations
  • KD/KO Validated

IRF8 Polyclonal antibody

IRF8 Polyclonal Antibody for WB, ELISA

Cat No. 24437-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

H-ICSBP, ICSBP1, Interferon consensus sequence-binding protein, interferon regulatory factor 8, IRF 8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells, Daudi cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24437-1-AP targets IRF8 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19909

Product name: Recombinant human IRF8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 121-426 aa of BC126247

Sequence: KLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV

Predict reactive species
Full Name ICSBP1
Calculated Molecular Weight 426 aa, 48 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC126247
Gene Symbol IRF8
Gene ID (NCBI) 3394
RRIDAB_2879549
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ02556
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IRFs comprise a family of transcription factors that function within the Jak/Stat pathway to regulate IFN and IFN-inducible gene expression in response to viral infection. IRFs predominantly express in lymphoid tissues and play an important role in pathogen defense, autoimmunity, lymphocyte development, cell growth, and susceptibility to transformation. The IRF family includes nine members: IRF-1, IRF-2, ISGF3γ/p48, IRF-3, IRF-4 (Pip/LSIRF/ICSAT), IRF-5, IRF-6, IRF-7, and IRF-8/ICSBP. All IRF proteins share homology in their amino-terminal DNA-binding domains. IRF family members regulate transcription through interactions with proteins that share similar DNA-binding motifs, such as IFN-stimulated response elements (ISRE), IFN consensus sequences (ICS), and IFN regulatory elements (IRF-E). IRF-8/ICSCP is expressed predominately in hematopoietic cells and is further increased upon treatment with IFN (2111015,1460054). IRF-8 can function as a transcription repressor of ICS-containing promoters (1460054). Expression of IRF-8 can lead to the down-regulation of the anti-apoptotic protein Bcl-2 (14656881). Originally described as being induced by IFN-γ, IRF-8 expression is also elevated by IRF-α as well as IL-12 in NK and T cells (14581002). IRF-8 deficient mice have enhanced susceptibility to various pathogens and impaired production of IFNs, as well as deregulated hematopoiesis that resembles chronic myelogenous leukemia (9120398). IRF-8 also regulates bone metabolism by suppressing osteoclast formation (19718038).This antibody specifically recognizes the 48kd IRF8 protein.

Protocols

Product Specific Protocols
WB protocol for IRF8 antibody 24437-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...