• Featured Product
  • KD/KO Validated

IWS1 Polyclonal antibody

IWS1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 16943-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Protein IWS1 homolog, IWS1-like protein, IWS1L, IWS1 like protein, IWS1 homolog (S. cerevisiae)

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, human brain tissue, mouse brain tissue, rat brain tissue, HeLa cells, Jurkat cells
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

ChIPSee 1 publications below

Product Information

16943-1-AP targets IWS1 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10554

Product name: Recombinant human IWS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-298 aa of BC017012

Sequence: HMDFLSDFEMMLQRKKSMSGKRRRNRDGGTFISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPAVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMNSTGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEMESSRFQATSKKGISRLDKQMRKFTDIRKKSRSAHAVKISIEGNKMPL

Predict reactive species
Full Name IWS1 homolog (S. cerevisiae)
Calculated Molecular Weight 819 aa, 92 kDa
Observed Molecular Weight 116-120 kDa
GenBank Accession NumberBC017012
Gene Symbol IWS1
Gene ID (NCBI) 55677
RRIDAB_2128229
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96ST2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IWS1, as a transcription elongation factor, functions to recruit cofactors to the RNA polymerase II (RNAPII) complex to regulate mRNA alternative splicing (PMID: 30846735; 37237004). It plays a key role in defining the composition of the RNA polymerase II (RNAPII) elongation complex and in modulating the production of mature mRNA transcripts. It also acts as an assembly factor to recruit various factors to the RNAPII elongation complex and is recruited to the complex via binding to the transcription elongation factor SUPT6H bound to the C-terminal domain (CTD) of the RNAPII subunit RPB1 (POLR2A). The SUPT6H:IWS1:CTD complex recruits mRNA export factors (ALYREF/THOC4, EXOSC10) as well as histone modifying enzymes (such as SETD2) to ensure proper mRNA splicing, efficient mRNA export and elongation-coupled H3K36 methylation, a signature chromatin mark of active transcription (PMID: 17184735; 17234882; 19141475).

Protocols

Product Specific Protocols
IF protocol for IWS1 antibody 16943-1-APDownload protocol
IHC protocol for IWS1 antibody 16943-1-APDownload protocol
IP protocol for IWS1 antibody 16943-1-APDownload protocol
WB protocol for IWS1 antibody 16943-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ChIP

Cell Host Microbe

The Integrase Cofactor LEDGF/p75 Associates with Iws1 and Spt6 for Postintegration Silencing of HIV-1 Gene Expression in Latently Infected Cells.

Authors - Annabelle Gérard

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Fabienne (Verified Customer) (06-12-2024)

Works great in western blot

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa, HEK293T and Jurkat cell lines
IWS1 Antibody Western Blot validation (1:1000 dilution) in HeLa, HEK293T and Jurkat cell lines (Cat no:16943-1-AP)
FH

Sarah (Verified Customer) (12-31-2020)

Works perfectly in WB and immunoprecipitation experiements (HeLa and HEL293T cells).

  • Applications: Western Blot, Immunoprecipitation, ChIP
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HeLa and HEK293T
Loading...
||
New chat Able
正在加载,请稍候...