Human Ig Lambda Light Chain Polyclonal antibody

Human Ig Lambda Light Chain Polyclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 20758-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF-P, ELISA

Human IgG Lambda Light Chain, Human IgG lambda chain, IgG Lambda Light Chain, IGLC1, IGLC

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman plasma tissue
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20758-1-AP targets Human Ig Lambda Light Chain in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14693

Product name: Recombinant human IGLC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-234 aa of BC007782

Sequence: MAWTVLLLGLLSHCTGSGTSYVLTQPASVSVAPGQTARITCGGSNLGSKSVNWYQLRPGQAPILVVYENKERPAGIPERLSALTSEETATLTISSVVAGDEADYFCQVWDTTSQQYVFGTGTQVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Predict reactive species
Full Name immunoglobulin lambda constant 1 (Mcg marker)
Calculated Molecular Weight 233 aa, 25 kDa
Observed Molecular Weight 25 kDa
GenBank Accession NumberBC007782
Gene Symbol IgG Lambda Light Chain
Gene ID (NCBI) 3537
RRIDAB_2878734
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

This antibody detects the lambda light chain of human immunoglobulin.

Protocols

Product Specific Protocols
IF protocol for Human Ig Lambda Light Chain antibody 20758-1-APDownload protocol
IHC protocol for Human Ig Lambda Light Chain antibody 20758-1-APDownload protocol
WB protocol for Human Ig Lambda Light Chain antibody 20758-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
IHC,IF

iScience

SFTSV infection is associated with transient overproliferation of monoclonal lambda-type plasma cells

Authors - Chuansong Quan
Loading...
||
New chat Able
正在加载,请稍候...