Tested Applications
| Positive WB detected in | rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
Product Information
25212-1-AP targets JIP3 in WB, ELISA applications and shows reactivity with human, rat, mouse samples.
| Tested Reactivity | human, rat, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19561 Product name: Recombinant human JIP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 171-248 aa of BC137123 Sequence: MIQTYVEHIERSKMQQVGGNSQTESSLPGRRKERPTSLNVFPLADGTVRAQIGGKLVPAGDHWHLSDLGQLQSSSSYQ Predict reactive species |
| Full Name | mitogen-activated protein kinase 8 interacting protein 3 |
| Calculated Molecular Weight | 1336 aa, 147 kDa |
| Observed Molecular Weight | 147 kDa |
| GenBank Accession Number | BC137123 |
| Gene Symbol | JIP3 |
| Gene ID (NCBI) | 23162 |
| RRID | AB_2879962 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UPT6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for JIP3 antibody 25212-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun SH3RF3 promotes breast cancer stem-like properties via JNK activation and PTX3 upregulation.
| ||
Saudi Pharm J iTRAQ-derived quantitative proteomics uncovers the neuroprotective property of bexarotene in a mice model of cerebral ischemia-reperfusion injury. | ||
JCI Insight A toxic gain of function variant in MAPK8IP3 provides novel insights into JIP3 cellular roles |

