Tested Applications
Positive WB detected in | mouse kidney tissue |
Positive IF detected in | mouse heart tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunofluorescence (IF) | IF : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
15150-1-AP targets KCNE1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | rat, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3495 Product name: Recombinant human KCNE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC036452 Sequence: MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS Predict reactive species |
Full Name | potassium voltage-gated channel, Isk-related family, member 1 |
Calculated Molecular Weight | 15 kDa |
Observed Molecular Weight | 15 kDa |
GenBank Accession Number | BC036452 |
Gene Symbol | KCNE1 |
Gene ID (NCBI) | 3753 |
RRID | AB_2131977 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P15382 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for KCNE1 antibody 15150-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Br J Pharmacol Aldosterone downregulates slowly activated delayed rectifier potassium current in adult guinea pig cardiomyocytes. | ||
Cardiovasc Ther LCZ696 Therapy Reduces Ventricular Tachyarrhythmia Inducibility in a Myocardial Infarction-Induced Heart Failure Rat Model. |