Tested Applications
Positive WB detected in | TF-1 cells, Jurkat cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 1 publications below |
Product Information
22739-1-AP targets KDM5D in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18690 Product name: Recombinant human KDM5D protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1375-1482 aa of BC146767 Sequence: SRTRSRALERRRRRQKVDQGRNVENLVQQELQSKRARSSGIMSQVGREEEHYQEKADRENMFLTPSTDHSPFLKGNQNSLQHKDSGSSAACPSLMPLLQLSYSDEQQL Predict reactive species |
Full Name | lysine (K)-specific demethylase 5D |
Calculated Molecular Weight | 1482 aa, 167 kDa |
Observed Molecular Weight | 70 kDa, 175 kDa |
GenBank Accession Number | BC146767 |
Gene Symbol | KDM5D |
Gene ID (NCBI) | 8284 |
RRID | AB_2879160 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BY66 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for KDM5D antibody 22739-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Transl Androl Urol KDM5D predicts response to docetaxel chemotherapy in metastatic castration resistant prostate cancer patients. | ||
Nat Metab Myc-mediated SDHA acetylation triggers epigenetic regulation of gene expression and tumorigenesis. |