Tested Applications
Positive WB detected in | L02 cells |
Positive IHC detected in | human stomach cancer tissue, human liver tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
23443-1-AP targets KHDC1 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20115 Product name: Recombinant human KHDC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 201-237 aa of BC022080 Sequence: DLSLAPRISGTVCLSVPQPSPYQVIGCSGFHLSSLYP Predict reactive species |
Full Name | KH homology domain containing 1 |
Calculated Molecular Weight | 237 aa, 27 kDa |
Observed Molecular Weight | 35-40 kDa |
GenBank Accession Number | BC022080 |
Gene Symbol | KHDC1 |
Gene ID (NCBI) | 80759 |
RRID | AB_2879280 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | Q4VXA5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KHDC1, also named as C6orf148, belongs to the KHDC1 family. KHDC1 has two isoforms with calculated MW 27 kDa and 18 kDa. It's a membrane protein. We got 35-40 kDa in our WB detection.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for KHDC1 antibody 23443-1-AP | Download protocol |
IHC protocol for KHDC1 antibody 23443-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |