Tested Applications
| Positive WB detected in | mouse lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 1 publications below |
Product Information
21904-1-AP targets DELE1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14615 Product name: Recombinant human KIAA0141 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 164-515 aa of BC007855 Sequence: QEEASAQPRNFSHNSLRGARPQDPSEEGPGDFGFLHASSSIESEAKPAQPQPTGEKEQDKSKTLSLEEAVTSIQQLFQLSVSITFNFLGTENMKSGDHTAAFSYFQKAAARGYSKAQYNAGLCHEHGRGTPRDISKAVLYYQLAASQGHSLAQYRYARCLLRDPASSWNPERQRAVSLLKQAADSGLREAQAFLGVLFTKEPYLDEQRAVKYLWLAANNGDSQSRYHLGICYEKGLGVQRNLGEALRCYQQSAALGNEAAQERLRALFSMGAAAPGPSDLTVTGLKSFSSPSLCSLNTLLAGTSRLPHASSTGNLGLLCRSGHLGASLEASSRAIPPHPYPLERSVVRLGFG Predict reactive species |
| Full Name | KIAA0141 |
| Calculated Molecular Weight | 515 aa, 56 kDa |
| Observed Molecular Weight | 56 kDa |
| GenBank Accession Number | BC007855 |
| Gene Symbol | DELE1 |
| Gene ID (NCBI) | 9812 |
| RRID | AB_2878942 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14154 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DELE1, also known as KIAA0141, is a 515 amino acid protein, which localizes in Mitochondrion and is detected in liver, skeletal muscle, kidney, pancreas, spleen, thyroid, testis, ovary, small intestine and colon. DELE1 is essential for the induction of death receptor-mediated apoptosis through the regulation of caspase activation. Mitochondrial malfunction needs to be relayed to the cytosol, where an integrated stress response is triggered by the phosphorylation of eukaryotic translation initiation factor 2α(eIF2α) in mammalian cells. eIF2αphosphorylation is mediated by the four eIF2α kinases GCN2, HRI, PERK and PKR, which are activated by diverse types of cellular stress. OMA1, a mitochondrial stress-activated protease; and DELE1, a little-characterized protein that we found was associated with the inner mitochondrial membrane. Mitochondrial stress stimulates OMA1-dependent cleavage of DELE1 and leads to the accumulation of DELE1 in the cytosol, where it interacts with HRI and activates the eIF2α kinase activity of HRI. In addition, DELE1 is required for ATF4 translation downstream of eIF2α phosphorylation.
Publications
| Species | Application | Title |
|---|---|---|
Antioxidants (Basel) Increased Mobile Zinc Regulates Retinal Ganglion Cell Survival via Activating Mitochondrial OMA1 and Integrated Stress Response | ||
bioRxiv Mitochondrial dysfunction heightens the integrated stress response to drive ALS pathogenesis. | ||
J Adv Res GL-V9 disrupts the mitochondrial homeostasis and triggers the integrated stress response by promoting the binding of cytosolic MDM2 with NDUFS1 in colorectal cancer. | ||
EMBO Mol Med Convergent activation of the integrated stress response and ER-mitochondria uncoupling in VAPB-associated ALS |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Damien (Verified Customer) (09-01-2023) | Unfortunately, in agreement with with Guo et al. Nature 2020, this antibody does not recognize endogenous DELE1.
|
FH Süleyman (Verified Customer) (12-06-2022) | CCCP treatment for 6 hour reduced the DELE1 level as it is published but I did not observe any cleaved DELE1, therefore it is hard to tell whether translation of DELE1 is reduced or cleaved. Some cell line has unspecific bands as well. I used 1:200 which is also a lot (antibody can be used quickly), one can test 1:500 or 1:1000 for WB.
![]() |
FH SITING (Verified Customer) (04-02-2021) | GOOD
|
FH Maria (Verified Customer) (02-10-2021) | DELE1 in human primary fibroblasts. 12% TGX gel. PVDF membrane. Blocking 3% BSA in PBST (0.1% Tween), primary incubation 1:1000 in PBST(0.1% Tween)+ 3% BSA 16h 4ºC. Secondary Goat anti rabbit HRP 1:5000 1h RT.
![]() |





