DELE1 Polyclonal antibody

DELE1 Polyclonal Antibody for WB, ELISA

Cat No. 21904-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

DELE, KIAA0141, DAP3-binding cell death enhancer 1, DAP3-binding cell death enhancer 1 short form, DAP3-binding cell death enhancer 1, long form (DELE1(L) )

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse lung tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

21904-1-AP targets DELE1 in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14615

Product name: Recombinant human KIAA0141 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 164-515 aa of BC007855

Sequence: QEEASAQPRNFSHNSLRGARPQDPSEEGPGDFGFLHASSSIESEAKPAQPQPTGEKEQDKSKTLSLEEAVTSIQQLFQLSVSITFNFLGTENMKSGDHTAAFSYFQKAAARGYSKAQYNAGLCHEHGRGTPRDISKAVLYYQLAASQGHSLAQYRYARCLLRDPASSWNPERQRAVSLLKQAADSGLREAQAFLGVLFTKEPYLDEQRAVKYLWLAANNGDSQSRYHLGICYEKGLGVQRNLGEALRCYQQSAALGNEAAQERLRALFSMGAAAPGPSDLTVTGLKSFSSPSLCSLNTLLAGTSRLPHASSTGNLGLLCRSGHLGASLEASSRAIPPHPYPLERSVVRLGFG

Predict reactive species
Full Name KIAA0141
Calculated Molecular Weight 515 aa, 56 kDa
Observed Molecular Weight 56 kDa
GenBank Accession NumberBC007855
Gene Symbol DELE1
Gene ID (NCBI) 9812
RRIDAB_2878942
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14154
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DELE1, also known as KIAA0141, is a 515 amino acid protein, which localizes in Mitochondrion and is detected in liver, skeletal muscle, kidney, pancreas, spleen, thyroid, testis, ovary, small intestine and colon. DELE1 is essential for the induction of death receptor-mediated apoptosis through the regulation of caspase activation. Mitochondrial malfunction needs to be relayed to the cytosol, where an integrated stress response is triggered by the phosphorylation of eukaryotic translation initiation factor 2α(eIF2α) in mammalian cells. eIF2αphosphorylation is mediated by the four eIF2α kinases GCN2, HRI, PERK and PKR, which are activated by diverse types of cellular stress. OMA1, a mitochondrial stress-activated protease; and DELE1, a little-characterized protein that we found was associated with the inner mitochondrial membrane. Mitochondrial stress stimulates OMA1-dependent cleavage of DELE1 and leads to the accumulation of DELE1 in the cytosol, where it interacts with HRI and activates the eIF2α kinase activity of HRI. In addition, DELE1 is required for ATF4 translation downstream of eIF2α phosphorylation.

Publications

SpeciesApplicationTitle
mouseWB

Antioxidants (Basel)

Increased Mobile Zinc Regulates Retinal Ganglion Cell Survival via Activating Mitochondrial OMA1 and Integrated Stress Response

Authors - Jiahui Tang
humanWB

EMBO Mol Med

Convergent activation of the integrated stress response and ER-mitochondria uncoupling in VAPB-associated ALS

Authors - Curran Landry

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Damien (Verified Customer) (09-01-2023)

Unfortunately, in agreement with with Guo et al. Nature 2020, this antibody does not recognize endogenous DELE1.

  • Applications: Western Blot
  • Cell Tissue Type: HEK293T, Hela cells
FH

Süleyman (Verified Customer) (12-06-2022)

CCCP treatment for 6 hour reduced the DELE1 level as it is published but I did not observe any cleaved DELE1, therefore it is hard to tell whether translation of DELE1 is reduced or cleaved. Some cell line has unspecific bands as well. I used 1:200 which is also a lot (antibody can be used quickly), one can test 1:500 or 1:1000 for WB.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: HeLa and HeLa Flip In TREX
DELE1 Antibody Western Blot validation (1:200 dilution) in HeLa and HeLa Flip In TREX (Cat no:21904-1-AP)
FH

SITING (Verified Customer) (04-02-2021)

GOOD

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEART
FH

Maria (Verified Customer) (02-10-2021)

DELE1 in human primary fibroblasts. 12% TGX gel. PVDF membrane. Blocking 3% BSA in PBST (0.1% Tween), primary incubation 1:1000 in PBST(0.1% Tween)+ 3% BSA 16h 4ºC. Secondary Goat anti rabbit HRP 1:5000 1h RT.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human Primary Fibroblasts
DELE1 Antibody Western Blot validation (1:1000 dilution) in Human Primary Fibroblasts (Cat no:21904-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...