Tested Applications
Positive WB detected in | PHA treated human PBMCs |
Positive IP detected in | mouse liver tissue |
Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 6 publications below |
IHC | See 6 publications below |
IF | See 3 publications below |
Product Information
16616-1-AP targets LAG-3/CD223 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9909 Product name: Recombinant human LAG3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 27-360 aa of BC052589 Sequence: AEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE Predict reactive species |
Full Name | lymphocyte-activation gene 3 |
Calculated Molecular Weight | 525 aa, 57 kDa |
Observed Molecular Weight | 60-70 kDa |
GenBank Accession Number | BC052589 |
Gene Symbol | LAG-3 |
Gene ID (NCBI) | 3902 |
RRID | AB_2133350 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P18627 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LAG-3, also known as CD223, is an immune checkpoint molecule that regulates both T-cell activation and homeostasis. LAG-3 is expressed on activated T cells, NK cells, regulatory T cells, and plasmacytoid dendritic cells. It is a CD4-related molecule that binds MHC class II. LAG-3 plays an important role in modulating T cell expansion and function, and blockade of LAG-3 with monoclonal antibodies can augment T cell function. (PMID: 15634887; 21086108; 28783703)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for LAG-3/CD223 antibody 16616-1-AP | Download protocol |
IHC protocol for LAG-3/CD223 antibody 16616-1-AP | Download protocol |
IF protocol for LAG-3/CD223 antibody 16616-1-AP | Download protocol |
IP protocol for LAG-3/CD223 antibody 16616-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cancer Immunol Immunother Novel roles of VAT1 expression in the immunosuppressive action of diffuse gliomas. | ||
Ann Transl Med Single-cell RNA-seq reveals transcriptional landscape and intratumor heterogenicity in gallbladder cancer liver metastasis microenvironment. | ||
Front Oncol The immune checkpoint expression in the tumor immune microenvironment of DLBCL: Clinicopathologic features and prognosis | ||
Int J Oncol Effect of DPP4/CD26 expression on SARS‑CoV‑2 susceptibility, immune response, adenosine (derivatives m62A and CD) regulations on patients with cancer and healthy individuals | ||
Br J Ophthalmol Implications of LAG3 and CTLA4 immune checkpoints beyond PD-1/PD-L1 as a potential target in determining the prognosis of uveal melanoma patients | ||
J Clin Invest Targeting fibrinogen-like protein 1 enhances immunotherapy in hepatocellular carcinoma |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sofia (Verified Customer) (05-27-2025) | Antibody did not work as expected even using the suggested antigen retrieval. I'll try it again using a different antigen retrieval.
|
FH Eman (Verified Customer) (09-20-2021) | the antibody works very well for WB the recommended dilution is 1:500 to 1:1000 i think we can even dilute it more this antibody is higly recommended
![]() |