Tested Applications
| Positive WB detected in | PHA treated human PBMCs |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 7 publications below |
| IHC | See 6 publications below |
| IF | See 3 publications below |
Product Information
16616-1-AP targets LAG-3/CD223 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9909 Product name: Recombinant human LAG3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 27-360 aa of BC052589 Sequence: AEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE Predict reactive species |
| Full Name | lymphocyte-activation gene 3 |
| Calculated Molecular Weight | 525 aa, 57 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC052589 |
| Gene Symbol | LAG-3 |
| Gene ID (NCBI) | 3902 |
| RRID | AB_2133350 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P18627 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LAG-3, also known as CD223, is an immune checkpoint molecule that regulates both T-cell activation and homeostasis. LAG-3 is expressed on activated T cells, NK cells, regulatory T cells, and plasmacytoid dendritic cells. It is a CD4-related molecule that binds MHC class II. LAG-3 plays an important role in modulating T cell expansion and function, and blockade of LAG-3 with monoclonal antibodies can augment T cell function. (PMID: 15634887; 21086108; 28783703)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LAG-3/CD223 antibody 16616-1-AP | Download protocol |
| IHC protocol for LAG-3/CD223 antibody 16616-1-AP | Download protocol |
| IP protocol for LAG-3/CD223 antibody 16616-1-AP | Download protocol |
| WB protocol for LAG-3/CD223 antibody 16616-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Immunol Immunother Novel roles of VAT1 expression in the immunosuppressive action of diffuse gliomas. | ||
Ann Transl Med Single-cell RNA-seq reveals transcriptional landscape and intratumor heterogenicity in gallbladder cancer liver metastasis microenvironment. | ||
iScience CD4+LAG3+T cells are decreased in SSc-ILD and affect fibroblast mesenchymal transition by TGF-β3 | ||
Pharmaceuticals (Basel) Effects of Nanosecond Pulsed Electric Field on Immune Checkpoint Receptors in Melanoma Cells | ||
Front Immunol Blockade of PD-1 and LAG-3 expression on CD8+ T cells promotes the tumoricidal effects of CD8+ T cells | ||
Reprod Sci The Identification of Gamma-Glutamyl Hydrolase in Uterine Corpus Endometrial Carcinoma: a Predictive Model and Machine Learning |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sofia (Verified Customer) (05-27-2025) | Antibody did not work as expected even using the suggested antigen retrieval. I'll try it again using a different antigen retrieval.
|
FH Eman (Verified Customer) (09-20-2021) | the antibody works very well for WB the recommended dilution is 1:500 to 1:1000 i think we can even dilute it more this antibody is higly recommended
![]() |












