Tested Applications
Positive WB detected in | human heart tissue, human skeletal muscle tissue |
Positive IHC detected in | human ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 6 publications below |
Product Information
10465-1-AP targets LAMA4 (Isoform 3) in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0736 Product name: Recombinant human LAMA4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC004241 Sequence: MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL Predict reactive species |
Full Name | laminin, alpha 4 |
Calculated Molecular Weight | 13 kDa |
Observed Molecular Weight | 11-13 kDa |
GenBank Accession Number | BC004241 |
Gene Symbol | Laminin alpha 4/LAMA4 |
Gene ID (NCBI) | 3910 |
RRID | AB_2234461 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q16363 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Laminin is a basement membrane glycoprotein composed of three nonidentical chains, A, B1, and B2 (PMID: 7959779). LAMA4 (laminin, alpha 4), an A chain variant, is a subunit of laminin-8 (laminin-411), laminin-9 (laminin-421) and laminin-14 (laminin-423) (PMID: 10842354; 10964957). LAMA4 is widely distributed in developing and adult human tissues, and mainly localized to mesenchyme-derived tissues (PMID: 12133914). It may have a role in formation and function of endothelium, transmigration of inflammatory cells through endothelium, and invasion of certain tumors (PMID: 17533363). Three alternatively spliced mRNAs give rise to three isoforms. This antibody was generated against the full length (1-120aa) of isoform 3.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for LAMA4 (Isoform 3) antibody 10465-1-AP | Download protocol |
IHC protocol for LAMA4 (Isoform 3) antibody 10465-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Sci Rep Novel candidate factors predicting the effect of S-1 adjuvant chemotherapy of pancreatic cancer. | ||
Am J Physiol Heart Circ Physiol Pygo1 regulates pathological cardiac hypertrophy via a β-catenin-dependent mechanism. | ||
Neuromuscul Disord Basement membrane remodelling and segmental fibrosis in sporadic inclusion body myositis. | ||
J Neurosci Res Maturational changes in laminin, fibronectin, collagen IV, and perlecan in germinal matrix, cortex, and white matter and effect of betamethasone. | ||
Cancer Cell Int MiR-539 inhibits proliferation and migration of triple-negative breast cancer cells by down-regulating LAMA4 expression. |