Tested Applications
| Positive WB detected in | A375 cells, mouse skin tissue, rat skin tissue |
| Positive IHC detected in | human skin tissue, human oesophagus tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A375 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21771-1-AP targets LCE1B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16442 Product name: Recombinant human LCE1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC104232 Sequence: MSCQQNQQQCQPPPKCIPKCPPKCLTPRCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC Predict reactive species |
| Full Name | late cornified envelope 1B |
| Calculated Molecular Weight | 118 aa, 12 kDa |
| Observed Molecular Weight | 10-12 kDa |
| GenBank Accession Number | BC104232 |
| Gene Symbol | LCE1B |
| Gene ID (NCBI) | 353132 |
| RRID | AB_10858482 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5T7P3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Human LCE1B (Late cornified envelope protein 1B), also named late envelope protein 2 (LEP2), is located at human Chromosome1q21 which contains multiple LCE clusters. LCE1B gene is predicated to encode a 118-aa protein, and is currently evidenced at transcript level. Its expression was skin-specific and was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue (PMID: 15854049). LCE genes respond to environmental stimuli such as calcium levels and ultraviolet (UV) light, however, LCE groups have distinct functions (PMID: 15854049).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LCE1B antibody 21771-1-AP | Download protocol |
| IHC protocol for LCE1B antibody 21771-1-AP | Download protocol |
| WB protocol for LCE1B antibody 21771-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |















