Tested Applications
| Positive WB detected in | HEK-293 cells, PC-12 cells, Neuro-2a cells, pig brain tissue, rat brain tissue, mouse brain tissue, rabbit brain tissue, mouse cerebellum tissue, rat cerebellum tissue |
| Positive IHC detected in | mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunohistochemistry (IHC) | IHC : 1:16000-1:64000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66425-1-Ig targets LDHB in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6605 Product name: Recombinant human LDHB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-334 aa of BC002362 Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL Predict reactive species |
| Full Name | lactate dehydrogenase B |
| Calculated Molecular Weight | 36 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC002362 |
| Gene Symbol | LDHB |
| Gene ID (NCBI) | 3945 |
| RRID | AB_2881796 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P07195 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LDHB, also named as LDH-H and NY-REN-46, belongs to the LDH/MDH superfamily. And LDH family. It is an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway.It is glycolytic enzymes and it is positively regulated by mTOR.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LDHB antibody 66425-1-Ig | Download protocol |
| IHC protocol for LDHB antibody 66425-1-Ig | Download protocol |
| WB protocol for LDHB antibody 66425-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Cell Metab Augmentation of scleral glycolysis promotes myopia through histone lactylation | ||
Acta Pharm Sin B Co-delivery of photosensitizer and diclofenac through sequentially responsive bilirubin nanocarriers for combating hypoxic tumors. | ||
Dev Cell HMOX1-LDHB interaction promotes ferroptosis by inducing mitochondrial dysfunction in foamy macrophages during advanced atherosclerosis | ||
Life Sci Aerobic exercise reduced the amount of CHRONO bound to BMAL1 and ameliorated glucose metabolic dysfunction in skeletal muscle of high-fat diet-fed mice | ||
Cell Death Dis PDK4 promotes vascular calcification by interfering with autophagic activity and metabolic reprogramming. | ||
J Steroid Biochem Mol Biol Very high-dose vitamin D₃ supplementation reduces the expression of genes and proteins engaged in β-oxidation in healthy pigs |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Maxence (Verified Customer) (08-28-2026) | This LDHB works in IF-P. The staining is good in human breast and kidney tissues. The IF was performed on FFPE human tissue slides with Dako antigen retrival pH9. Primary incubation was performed at 1:100 overnight (16h) at 4°C. Secondary incubation was performed with Goat anti-Mouse at 1:2000 for 2h at RT. Image were taken with a Leica THUNDER at 10x and 20x magnification.
![]() |
Reema (Verified Customer) (09-07-2022) | The antibody worked really good with western blot. I would refer this to anyone who is doing western blotting with rat tissue samples.
|








