Use Able AI chat for product recommendations

LDHB Monoclonal antibody

LDHB Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66425-1-Ig
Clone No.5E9G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, CoIP, ELISA

lactate dehydrogenase B, 5E9G1, EC:1.1.1.27, LDH, LDH B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, PC-12 cells, Neuro-2a cells, pig brain tissue, rat brain tissue, mouse brain tissue, rabbit brain tissue, mouse cerebellum tissue, rat cerebellum tissue
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunohistochemistry (IHC)IHC : 1:16000-1:64000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66425-1-Ig targets LDHB in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6605

Product name: Recombinant human LDHB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-334 aa of BC002362

Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

Predict reactive species
Full Name lactate dehydrogenase B
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC002362
Gene Symbol LDHB
Gene ID (NCBI) 3945
RRIDAB_2881796
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP07195
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LDHB, also named as LDH-H and NY-REN-46, belongs to the LDH/MDH superfamily. And LDH family. It is an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway.It is glycolytic enzymes and it is positively regulated by mTOR.

Protocols

Product Specific Protocols
IF protocol for LDHB antibody 66425-1-IgDownload protocol
IHC protocol for LDHB antibody 66425-1-IgDownload protocol
WB protocol for LDHB antibody 66425-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Cell Metab

Augmentation of scleral glycolysis promotes myopia through histone lactylation

Authors - Xiaolei Lin
mouse,humanWB

Acta Pharm Sin B

Co-delivery of photosensitizer and diclofenac through sequentially responsive bilirubin nanocarriers for combating hypoxic tumors.

Authors - Yang Zhou
human

Dev Cell

HMOX1-LDHB interaction promotes ferroptosis by inducing mitochondrial dysfunction in foamy macrophages during advanced atherosclerosis

Authors - Xiang Peng
mouseWB

Life Sci

Aerobic exercise reduced the amount of CHRONO bound to BMAL1 and ameliorated glucose metabolic dysfunction in skeletal muscle of high-fat diet-fed mice

Authors - Lei Xu
ratWB,IF

Cell Death Dis

PDK4 promotes vascular calcification by interfering with autophagic activity and metabolic reprogramming.

Authors - Wen-Qi Ma
pigWB

J Steroid Biochem Mol Biol

Very high-dose vitamin D₃ supplementation reduces the expression of genes and proteins engaged in β-oxidation in healthy pigs

Authors - Anna Steg

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Maxence (Verified Customer) (08-28-2026)

This LDHB works in IF-P. The staining is good in human breast and kidney tissues. The IF was performed on FFPE human tissue slides with Dako antigen retrival pH9. Primary incubation was performed at 1:100 overnight (16h) at 4°C. Secondary incubation was performed with Goat anti-Mouse at 1:2000 for 2h at RT. Image were taken with a Leica THUNDER at 10x and 20x magnification.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Breast and Human Kidney
LDHB Antibody Immunofluorescence validation (1:100 dilution) in Human Breast and Human Kidney (Cat no:66425-1-Ig)

Reema (Verified Customer) (09-07-2022)

The antibody worked really good with western blot. I would refer this to anyone who is doing western blotting with rat tissue samples.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: rat
LDHB Antibody Western Blot validation (1:1000 dilution) in rat (Cat no:66425-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...