Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

LGALS3BP Polyclonal antibody

LGALS3BP Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10281-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

90K, BTBD17B, Galectin 3 binding protein, Galectin-3-binding protein, Lectin galactoside-binding soluble 3-binding protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, COLO 320 cells, HEK-293 cells, fetal human brain tissue, HepG2 cells, A549 cells, human milk tissue, human plasma tissue
Positive IP detected inHepG2 cells, HEK-293 cells
Positive IHC detected inhuman oesophagus cancer tissue, human breast cancer tissue, human colon cancer, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10281-1-AP targets LGALS3BP in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, pig, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0294

Product name: Recombinant human LGALS3BP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 6-221 aa of BC002403

Sequence: LFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITL

Predict reactive species
Full Name lectin, galactoside-binding, soluble, 3 binding protein
Calculated Molecular Weight 585 aa, 65 kDa
Observed Molecular Weight 65-90 kDa
GenBank Accession NumberBC002403
Gene Symbol LGALS3BP
Gene ID (NCBI) 3959
RRIDAB_2137066
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ08380
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin-3-binding protein (LGALS3BP, also known as 90K or Mac-2 BP) is a secreted glycoprotein which binds galectin-3, galectin-1, beta1 integrins, collagens and fibronectin (PMID: 8034587; 8024581; 11146440; 9501082). It has been implicated in tumor metastatic processes, as well as in other cell adhesion and immune functions. Levels of LGALS3BP have been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV) (PMID: 7698018). Western analysis suggests that LGALS3BP is found in breast milk, semen, saliva, urine, and tears, in addition to serum (PMID: 8390986 ).

Protocols

Product Specific Protocols
IF protocol for LGALS3BP antibody 10281-1-APDownload protocol
IHC protocol for LGALS3BP antibody 10281-1-APDownload protocol
IP protocol for LGALS3BP antibody 10281-1-APDownload protocol
WB protocol for LGALS3BP antibody 10281-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Nat Commun

Interactome analysis reveals that lncRNA HULC promotes aerobic glycolysis through LDHA and PKM2.

Authors - Chunqing Wang
humanIHC

Cancer Res

A galectin-3-dependent pathway upregulates interleukin-6 in the microenvironment of human neuroblastoma.

Authors - Silverman Ayaka M AM
  • KD Validated
humanIF

Blood Adv

Increased Mac-2 binding protein glycan isomer in patients at risk for late nonrelapse mortality after HSCT.

Authors - Yu Akahoshi
mouseWB

PLoS Pathog

Inducible LGALS3BP/90K activates antiviral innate immune responses by targeting TRAF6 and TRAF3 complex.

Authors - Gang Xu
humanWB

Thromb Haemost

Proteomic discovery of 21 proteins expressed in human plasma-derived but not platelet-derived microparticles.

Authors - Smalley David M DM
humanIHC

Cancer Sci

MZT2A promotes NSCLC viability and invasion by increasing Akt phosphorylation via the MOZART2 domain.

Authors - Huanxi Wang

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Shriya (Verified Customer) (10-28-2025)

  • Applications: Western Blot

Emma (Verified Customer) (03-15-2022)

Beautiful antibody - produces a single band at the correct size.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: LNCaP
Loading...
||
New chat

Able

正在加载,请稍候...