Product Information
14998-1-AP targets SMAGP in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6988 Product name: Recombinant human LOC57228 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-46 aa of BC003379 Sequence: MNLQKVSPVPSSRWRVTWPRAARKRNISSNDSQAPRSLFLAPSLTR Predict reactive species |
| Full Name | small trans-membrane and glycosylated protein |
| Calculated Molecular Weight | 6 kDa |
| GenBank Accession Number | BC003379 |
| Gene Symbol | SMAGP |
| Gene ID (NCBI) | 57228 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q0VAQ4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Small cell transmembrane and glycosylated protein (SMAGP) is an evolutionary conserved protein expressed on the lateral epithelial cell membrane. Altered expression of SMAGP has been reported in cancer, suggesting that SMAGP may have a role in tumor progression (PMID: 15021913; 15986429). This polyclonal antibody is raised against LOC57228 protein (GenBank: AAC72956.1; Uniprot Database Entry: O95332).
