LPPR2 Polyclonal antibody

LPPR2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25732-1-AP

Publications (3)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

Inactive phospholipid phosphatase PLPPR2, Lipid phosphate phosphatase-related protein type 2, Phospholipid phosphatase-related protein type 2, Plasticity-related gene 4 protein, PLPPR2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of 3T3-L1 using 25732-1-AP
3T3-L1 cells were subjected to SDS PAGE followed by western blot with 25732-1-AP (LPPR2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 25732-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 25732-1-AP (LPPR2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skeletal muscle using 25732-1-AP
Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 25732-1-AP (LPPR2 Antibody) at dilution of 1:100 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skeletal muscle using 25732-1-AP
Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 25732-1-AP (LPPR2 Antibody) at dilution of 1:100 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 25732-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 25732-1-AP (LPPR2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 25732-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 25732-1-AP (LPPR2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 25732-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25732-1-AP (LPPR2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LPPR2 in ?

Overview

Tested Applications
Product Information
Publications (3)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	3T3-L1 cells, HeLa cells
Positive IHC detected in	human kidney tissue, human liver cancer tissue, human skeletal muscle tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25732-1-AP targets LPPR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human, mouse, rabbit
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22839 Product name: Recombinant human LPPR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 272-343 aa of BC009378 Sequence: TGAAIATFLVTCVVHNFQSRPPSGRRLSPWEDLGQAPTMDSPLEKNPRSAGRIRHRHGSPHPSRRTAPAVAT Predict reactive species
Full Name	lipid phosphate phosphatase-related protein type 2
Calculated Molecular Weight	427 aa, 46 kDa
Observed Molecular Weight	37 kDa
GenBank Accession Number	BC009378
Gene Symbol	LPPR2
Gene ID (NCBI)	64748
RRID	AB_2880215
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q96GM1
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for LPPR2 antibody 25732-1-AP	Download protocol
WB protocol for LPPR2 antibody 25732-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The LPPR2 Polyclonal antibody (Cat# 25732-1-AP) has 3 citations. They appear in Nature Communications (spatial transcriptomics and immune heterogeneity), Materials Today Bio (osteochondral repair and cartilage phenotype maintenance), and Placenta (SWATH proteomics of placental tissue in intrahepatic cholestasis of pregnancy). Research fields span immunology, tissue engineering, and reproductive medicine, with applications in IHC and WB across mouse, rabbit, and human species.

Species	Application	Title
mouse	IHC	Nat Commun Ultra-precision deconvolution of spatial transcriptomics decodes immune heterogeneity and fate-defining programs in tissues. Authors - Yin Xu View Article
rabbit	WB	Mater Today Bio Kartogenin-loaded chitosan composite scaffold with cartilage-mimetic microstructure for layered osteochondral repair and cartilage phenotype maintenance. Authors - Hengyu Liu View Article
human	WB	Placenta SWATH proteomics analysis of placental tissue with intrahepatic cholestasis of pregnancy Authors - Yuxuan Jiang View Article