Tested Applications
| Positive WB detected in | 3T3-L1 cells, HeLa cells |
| Positive IHC detected in | human kidney tissue, human liver cancer tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
25732-1-AP targets LPPR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, rabbit |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22839 Product name: Recombinant human LPPR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 272-343 aa of BC009378 Sequence: TGAAIATFLVTCVVHNFQSRPPSGRRLSPWEDLGQAPTMDSPLEKNPRSAGRIRHRHGSPHPSRRTAPAVAT Predict reactive species |
| Full Name | lipid phosphate phosphatase-related protein type 2 |
| Calculated Molecular Weight | 427 aa, 46 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC009378 |
| Gene Symbol | LPPR2 |
| Gene ID (NCBI) | 64748 |
| RRID | AB_2880215 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96GM1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for LPPR2 antibody 25732-1-AP | Download protocol |
| WB protocol for LPPR2 antibody 25732-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mater Today Bio Kartogenin-loaded chitosan composite scaffold with cartilage-mimetic microstructure for layered osteochondral repair and cartilage phenotype maintenance. | ||
Placenta SWATH proteomics analysis of placental tissue with intrahepatic cholestasis of pregnancy |













