Tested Applications
| Positive WB detected in | human plasma |
| Positive IHC detected in | mouse liver tissue, human liver tissue, human liver cancer tissue, human pancreas cancer tissue, mouse brain tissue, mouse pancreas tissue, mouse prostate tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13224-1-AP targets LRG1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3964 Product name: Recombinant human LRG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 42-347 aa of BC034389 Sequence: DCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ Predict reactive species |
| Full Name | leucine-rich alpha-2-glycoprotein 1 |
| Calculated Molecular Weight | 347 aa, 38 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC034389 |
| Gene Symbol | LRG1 |
| Gene ID (NCBI) | 116844 |
| RRID | AB_2138714 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02750 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LRG1, also known as LRG, is a member of the leucine-rich repeat (LRR) family of proteins, containing eight LRR (leucine-rich) repeats and one LRRCT domain. The gene of LRG1 maps to chromosome 19p13.3, and encodes a 347-amino acid protein with a predicted unmodified molecular weight of 38 kD. The mature form of LRG1 is a secreted glycoprotein which has 312 amino acids and an experimentally determined molecular mass of 45 kD. The LRR family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation. Levels of the LRG protein are markedly elevated in acute appendicitis and therefore could be used as a diagnostic aid.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for LRG1 antibody 13224-1-AP | Download protocol |
| WB protocol for LRG1 antibody 13224-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-LRG1 (Leucine-rich alpha-2-glycoprotein 1) antibody, catalog number 13224-1-AP, has accumulated 46 citations in journals such as Kidney International, Science Translational Medicine, Theranostics, Advanced Science, Journal of Controlled Release, Diabetes, Oncotarget, and Nature Medicine. Associated research fields include diabetes, pathological angiogenesis, multiple cancers (bladder, colorectal, melanoma, ovarian, breast, pancreatic, hepatocellular, renal cell), renal fibrosis, cerebral ischemia-reperfusion injury, wound healing, osteoporosis, ulcerative colitis, and neuroinflammation.
| Species | Application | Title |
|---|---|---|
Kidney Int Gene expression profiles of glomerular endothelial cells support their role in the glomerulopathy of diabetic mice. | ||
Bone Res Metformin accelerates bone fracture healing by promoting type H vessel formation through inhibition of YAP1/TAZ expression | ||
Sci Transl Med Leucine-rich α-2-glycoprotein 1 initiates the onset of diabetic retinopathy in mice | ||
Theranostics LRG1 inhibition promotes acute pancreatitis recovery by inducing cholecystokinin Type 1 receptor expression via Akt | ||
Adv Sci (Weinh) LRG1 Drives Pathological Angiogenesis by Disrupting Neutrophil Mitochondrial Homeostasis in Bladder Cancer. |
Reviews
What customers say
Both reviewers (the same user) rated this antibody 1 out of 5 stars for IHC on mouse prostate tissue. They tested dilutions of 1:400, 1:800, and 1:2000 and reported very nonspecific staining across all three concentrations. No positive or neutral feedback was provided. Overall, the reviews indicate poor performance in immunohistochemistry applications with significant background/nonspecific binding issues.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
didem (Verified Customer) (09-04-2025) | IHC of mouse prostate tissue. I tested 1:400, 1:800, and 1:2000 antibody dilutions. Images captured at 20x are attached.
 |
didem (Verified Customer) (08-28-2025) | anti-mouse LRG1 antibody We've got very nonspecific staining at the three concentrations tested.
|
