Tested Applications
| Positive WB detected in | HeLa cells |
| Positive IHC detected in | mouse lung tissue, human hepatocirrhosis tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24899-1-AP targets LRP5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19034 Product name: Recombinant human LRP5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1332-1397 aa of BC150595 Sequence: CDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSL Predict reactive species |
| Full Name | low density lipoprotein receptor-related protein 5 |
| Calculated Molecular Weight | 1615 aa, 179 kDa |
| Observed Molecular Weight | 180-200 kDa |
| GenBank Accession Number | BC150595 |
| Gene Symbol | LRP5 |
| Gene ID (NCBI) | 4041 |
| RRID | AB_2879786 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75197 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Low-density lipoprotein receptor-related protein 5 (LRP5) is a single-pass type I membrane protein with EGF-like and LDLR domains in the extracellular domain. LRP5 and LRP6 act as coreceptors with Frizzled for Wnt. The complex of Wnt-Fzd-LRP5-LRP6 triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes. LRP5 plays a key role in skeletal homeostasis and many bone density related diseases are caused by mutations in LRP5 gene.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LRP5 antibody 24899-1-AP | Download protocol |
| IHC protocol for LRP5 antibody 24899-1-AP | Download protocol |
| WB protocol for LRP5 antibody 24899-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
LRP5 Polyclonal antibody (24899-1-AP) has 18 total citations. These appear in journals including Signal Transduction and Targeted Therapy, Cell Stem Cell, Cancer Research, Phytomedicine, Advanced Healthcare Materials, Antioxidants, Stem Cell Research & Therapy, Marine Drugs, International Immunopharmacology, Frontiers in Pharmacology, World Journal of Diabetes, iScience, Calcified Tissue International, Iranian Journal of Basic Medical Sciences, Chinese Journal of Integrative Medicine, Pharmaceutical Biology, and Journal of Orthopaedic Science. Research fields include Wnt signaling, cancer stemness, osteoporosis, liver fibrosis, and inflammatory diseases.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Gut dysbiosis conveys psychological stress to activate LRP5/β-catenin pathway promoting cancer stemness | ||
Cell Stem Cell Lgr5-expressing secretory cells form a Wnt inhibitory niche in cartilage critical for chondrocyte identity | ||
Cancer Res CRTC2 Forms Co-condensates with YTHDF2 that Enhance Translational Efficiency of m6A-Modified mRNAs to Drive Hepatocarcinogenesis and Lenvatinib Resistance | ||
Phytomedicine Pectolinarigenin ameliorates osteoporosis via enhancing Wnt signaling cascade in PPARβ-dependent manner | ||
Phytomedicine Modified Fuzheng Yiliu Decoction chemosensitizes colorectal cancer by inhibiting cancer stem cell metabolism and stemness through CAV1/ZNF460/GRP78 signaling. | ||
Adv Healthc Mater A Highly Bioactive Organic-Inorganic Nanoparticle for Activating Wnt10b Mediated Osteogenesis by Specifically Anchor CCN3 Protein |
