Tested Applications
| Positive WB detected in | HeLa cells, HL-60 cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:750-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10134-1-AP targets LSM8 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0178 Product name: Recombinant human LSM8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC002742 Sequence: MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH Predict reactive species |
| Full Name | LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae) |
| Calculated Molecular Weight | 14 kDa /75 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC002742 |
| Gene Symbol | LSM8 |
| Gene ID (NCBI) | 51691 |
| RRID | AB_513438 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95777 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing[PMID:15075370]. Lsm2-Lsm8 (Lsm stands for Like Sm), binds and stabilizes the 3′ end of the spliceosomal U6 snRNA Lsm proteins facilitate the annealing of U6 snRNA with U4 snRNA in vitro and interact with the U4/U6 annealing factor Prp24, suggesting that Lsm proteins function in U4/U6 snRNP formation in vivo [PMID:15485930, 17251193].
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LSM8 antibody 10134-1-AP | Download protocol |
| IHC protocol for LSM8 antibody 10134-1-AP | Download protocol |
| WB protocol for LSM8 antibody 10134-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The LSM8 polyclonal antibody (Cat# 10134-1-AP) has 2 total citations. These appear in Molecular Cell (2020) and Journal of Cell Biology (2024). The cited research fields include U6 snRNA modification and splicing fidelity in spermatogenesis, as well as Cajal body structure and coilin interactor identification. Both studies used the antibody for Western blot, with the latter also employing co-immunoprecipitation.
| Species | Application | Title |
|---|---|---|
Mol Cell LARP7-Mediated U6 snRNA Modification Ensures Splicing Fidelity and Spermatogenesis in Mice. | ||
J Cell Biol Identification of coilin interactors reveals coordinated control of Cajal body number and structure |









