Tested Applications
| Positive WB detected in | mouse kidney tissue, rat kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
22144-1-AP targets LY6E in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17573 Product name: Recombinant human LY6E protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-101 aa of BC119708 Sequence: LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS Predict reactive species |
| Full Name | lymphocyte antigen 6 complex, locus E |
| Calculated Molecular Weight | 131 aa, 14 kDa |
| Observed Molecular Weight | 12-16 kDa |
| GenBank Accession Number | BC119708 |
| Gene Symbol | LY6E |
| Gene ID (NCBI) | 4061 |
| RRID | AB_2879007 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16553 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The predicted MW of LY6E is 13 kDa. Catalog#22144-1-AP recognises two band of 13 kDa and 18 kDa, and the additional 18 kDa band may be due to glycosylation.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for LY6E antibody 22144-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Lab Chip LY6E protein facilitates adeno-associated virus crossing in a biomimetic chip model of the human blood-brain barrier | ||
Carcinogenesis α5-nAChR associated with Ly6E modulates cell migration via TGF-β1/Smad signaling in non-small cell lung cancer. | ||
J Virol LY6E Restricts the Entry of Human Coronaviruses, Including the Currently Pandemic SARS-CoV-2.
| ||
PLoS Pathog Glycosylphosphatidylinositol biosynthesis functions as a conserved host defense pathway against coronaviruses via regulation of LY6E. | ||
Breast Cancer Res Nuclear PD-L1 drives IFN-γ-promoted lung metastasis of triple-negative breast cancer via POLR2A-mediated transcriptional activation of LY6E. |

