Filter:
Tested Applications
| Positive WB detected in | Raji cells |
| Positive IHC detected in | human testis tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23933-1-AP targets LY6H in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20762 Product name: Recombinant human LY6H protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 20-140 aa of BC028894 Sequence: SAPAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP Predict reactive species |
| Full Name | lymphocyte antigen 6 complex, locus H |
| Calculated Molecular Weight | 15 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | BC028894 |
| Gene Symbol | LY6H |
| Gene ID (NCBI) | 4062 |
| RRID | AB_2879366 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | O94772 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LY6H is highly expressed in particular subdivisions of human brain and also in MOLT-3 and -4 acute lymphoblastic leukemia cells. It has some isoforms with MW 14-16 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for LY6H antibody 23933-1-AP | Download protocol |
| WB protocol for LY6H antibody 23933-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
