Featured Product
KD/KO Validated

MBD3 Polyclonal antibody

MBD3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14258-1-AP

Publications(14)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

Synonyms

Methyl-CpG-binding protein MBD3, Methyl-CpG-binding domain protein 3, MBD 3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis of Y79 using 14258-1-AP
Y79 cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of MCF-7 using 14258-1-AP
MCF7 cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of COLO 320 using 14258-1-AP
COLO 320 cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse testis using 14258-1-AP
mouse testis tissue were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Y79 using 14258-1-AP
Y79 cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Jurkat using 14258-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 14258-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 14258-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of MCF-7 using 14258-1-AP
MCF7 cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of MCF-7 using 14258-1-AP
MCF7 cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Y79 using 14258-1-AP
Y79 cells were subjected to SDS PAGE followed by western blot with 14258-1-AP (MBD3 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of mouse testis using 14258-1-AP
IP result of anti-MBD3 (IP:14258-1-AP, 4ug; Detection:14258-1-AP 1:800) with mouse testis tissue lysate 4000ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human endometrial cancer using 14258-1-AP
Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 14258-1-AP (MBD3 antibody) at dilution of 1:100 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human endometrial cancer using 14258-1-AP
Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 14258-1-AP (MBD3 antibody) at dilution of 1:100 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 14258-1-AP
Immunofluorescent analysis of HepG2 cells, using MBD3 antibody 14258-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 14258-1-AP
Immunofluorescent analysis of HepG2 cells, using MBD3 antibody 14258-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (14)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Y79 cells, COLO 320 cells, HeLa cells, Jurkat cells, MCF-7 cells, mouse testis tissue
Positive IP detected in	mouse testis tissue
Positive IHC detected in	human endometrial cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)/ICC	IF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14258-1-AP targets MBD3 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag5531 Product name: Recombinant human MBD3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-259 aa of BC043619 Sequence: MERKSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV Predict reactive species
Full Name	methyl-CpG binding domain protein 3
Calculated Molecular Weight	33 kDa
Observed Molecular Weight	33 kDa
GenBank Accession Number	BC043619
Gene Symbol	MBD3
Gene ID (NCBI)	53615
RRID	AB_2139745
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O95983
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MBD3 does not bind DNA by itself. It recruits histone deacetylases and DNA methyltransferases. MBD3 acts as transcriptional repressor and plays a role in gene silencing.(PMID:9774669) .

Protocols

Product Specific Protocols
IF protocol for MBD3 antibody 14258-1-AP	Download protocol
IHC protocol for MBD3 antibody 14258-1-AP	Download protocol
IP protocol for MBD3 antibody 14258-1-AP	Download protocol
WB protocol for MBD3 antibody 14258-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB	Nat Commun Low chorionic villous succinate accumulation associates with recurrent spontaneous abortion risk. Authors - Xiao-Hui Wang KD Validated View Article
		Dev Cell Nucleoporin Seh1 controls murine neocortical development via transcriptional repression of p21 in neural stem cells Authors - Wenxiu Dai View Article
	WB,IHC	J Exp Med PMID: 32181805 Authors - Xiaoyan Zhan View Article
human	WB,IF	Proc Natl Acad Sci U S A Compensatory functions of histone deacetylase 1 (HDAC1) and HDAC2 regulate transcription and apoptosis during mouse oocyte development. Authors - Ma Pengpeng P View Article
human	WB,IHC	Cancers (Basel) MBD3 as a Potential Biomarker for Colon Cancer: Implications for Epithelial-Mesenchymal Transition (EMT) Pathways Authors - Yuntao Ding View Article
human	WB,ChIP	Oncol Lett Demethylation of HACE1 gene promoter by propofol promotes autophagy of human A549 cells. Authors - Shanshan Li View Article