Tested Applications
| Positive WB detected in | Jurkat cells, K-562 cells, mouse spleen tissue, HL-60 cells |
| Positive IF/ICC detected in | U-251 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
26098-1-AP targets MBTD1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22059 Product name: Recombinant human MBTD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-40 aa of BC101736 Sequence: MGTCWGDISENVRVEVPNTDCSLPTKVFWIAGIVKLAGYN Predict reactive species |
| Full Name | mbt domain containing 1 |
| Calculated Molecular Weight | 628 aa, 70 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC101736 |
| Gene Symbol | MBTD1 |
| Gene ID (NCBI) | 54799 |
| RRID | AB_2880374 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q05BQ5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MBTD1 antibody 26098-1-AP | Download protocol |
| WB protocol for MBTD1 antibody 26098-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









