Featured Product
KD/KO Validated

ME1 Polyclonal antibody

ME1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16619-1-AP

Publications(29)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EC:1.1.1.40, Malic enzyme 1, NADP-dependent malic enzyme, NADP-ME

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis using 16619-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 16619-1-AP (ME1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse placenta using 16619-1-AP
mouse placenta tissue were subjected to SDS PAGE followed by western blot with 16619-1-AP (ME1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 16619-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 16619-1-AP (ME1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 16619-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 16619-1-AP (ME1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 16619-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 16619-1-AP (ME1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of mouse liver using 16619-1-AP
IP result of anti-ME1 (IP:16619-1-AP, 4ug; Detection:16619-1-AP 1:2000) with mouse liver tissue lysate 2400 ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 16619-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 16619-1-AP (ME1 antibody) at dilution of 1:100 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 16619-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 16619-1-AP (ME1 antibody) at dilution of 1:100 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 16619-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 16619-1-AP (ME1 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 16619-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 16619-1-AP (ME1 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 16619-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta using 16619-1-AP (ME1 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 16619-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta using 16619-1-AP (ME1 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 16619-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ME1 antibody (16619-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (29)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, mouse liver tissue, mouse placenta tissue, MCF-7 cells, rat liver tissue
Positive IP detected in	mouse liver tissue
Positive IHC detected in	human liver tissue, human placenta tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:12000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16619-1-AP targets ME1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag9916 Product name: Recombinant human ME1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 226-572 aa of BC025246 Sequence: DEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ Predict reactive species
Full Name	malic enzyme 1, NADP(+)-dependent, cytosolic
Calculated Molecular Weight	572 aa, 64 kDa
Observed Molecular Weight	55-64 kDa
GenBank Accession Number	BC025246
Gene Symbol	ME1
Gene ID (NCBI)	4199
RRID	AB_2143821
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P48163
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ME1(NADP-dependent malic enzyme) belongs to the malic enzymes family. This malic enzyme catalyzes the reversible oxidative decarboxylation of malate and is a link between the glycolytic pathway and the citric acid cycle. The reaction is L-malate plus NADP(+) to form pyruvate, CO(2), and NADPH. The predicted protein contains 572 amino acids and has a calculated molecular mass of 64.1 kDa.

Protocols

Product Specific Protocols
IF protocol for ME1 antibody 16619-1-AP	Download protocol
IHC protocol for ME1 antibody 16619-1-AP	Download protocol
IP protocol for ME1 antibody 16619-1-AP	Download protocol
WB protocol for ME1 antibody 16619-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB	Cancer Cell Nrf2 redirects glucose and glutamine into anabolic pathways in metabolic reprogramming. Authors - Yoichiro Mitsuishi View Article
mouse	WB,IHC	Adv Sci (Weinh) Malic Enzyme 1 as a Novel Anti-Ferroptotic Regulator in Hepatic Ischemia/Reperfusion Injury Authors - Xuexian Fang View Article
		Mol Cell Dynamic Regulation of ME1 Phosphorylation and Acetylation Affects Lipid Metabolism and Colorectal Tumorigenesis. Authors - Yahui Zhu View Article
human	WB	Cell Res cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions. Authors - Linchong Sun View Article
mouse	WB	Cell Rep Targeting CXCR1 alleviates hyperoxia-induced lung injury through promoting glutamine metabolism Authors - Hao Qin View Article
	WB	Cell Rep Inhibiting G6PD by quercetin promotes degradation of EGFR T790M mutation Authors - Zehe Ge View Article

Reviews

5.0 out of 5

Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Chi (Verified Customer) (10-17-2024)

I have found the antibody in a publication (https://pubmed.ncbi.nlm.nih.gov/22789539/) and have tested the antibody myself. The antibody works great in WB with no background.