Featured Product
KD/KO Validated

ME2 Polyclonal antibody

ME2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 24944-1-AP

Publications(8)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA

Synonyms

EC:1.1.1.38, Malic enzyme 2, NAD-dependent malic enzyme, mitochondrial, NAD-ME

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHC

WB analysis using 24944-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 24944-1-AP (ME2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 24944-1-AP
WB result of ME2 antibody (24944-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ME2 transfected HepG2 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 24944-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 24944-1-AP (ME2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Jurkat using 24944-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 24944-1-AP (ME2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HL-60 using 24944-1-AP
HL-60 cells were subjected to SDS PAGE followed by western blot with 24944-1-AP (ME2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 24944-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 24944-1-AP (ME2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Jurkat using 24944-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 24944-1-AP (ME2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of HeLa using 24944-1-AP
IP result of anti-ME2 (IP:24944-1-AP, 4ug; Detection:24944-1-AP 1:500) with HeLa cells lysate 3200ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 24944-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 24944-1-AP (ME2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 24944-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 24944-1-AP (ME2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse colon using 24944-1-AP
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 24944-1-AP (ME2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 24944-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 24944-1-AP (ME2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 24944-1-AP
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 24944-1-AP (ME2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat brain using 24944-1-AP
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24944-1-AP (ME2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat heart using 24944-1-AP
Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 24944-1-AP (ME2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat brain using 24944-1-AP
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24944-1-AP (ME2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon using 24944-1-AP
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 24944-1-AP (ME2 Antibody) at dilution of 1:200 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon using 24944-1-AP
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 24944-1-AP (ME2 Antibody) at dilution of 1:200 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (8)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HL-60 cells, HeLa cells, Jurkat cells, K-562 cells
Positive IP detected in	HeLa cells
Positive IHC detected in	human pancreas cancer tissue, human colon tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:16000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:100-1:400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24944-1-AP targets ME2 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag20741 Product name: Recombinant human ME2 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 136-480 aa of BC000147 Sequence: SISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGYRIPIC Predict reactive species
Full Name	malic enzyme 2, NAD(+)-dependent, mitochondrial
Calculated Molecular Weight	65 kDa
Observed Molecular Weight	54 kDa, 65 kDa
GenBank Accession Number	BC000147
Gene Symbol	ME2
Gene ID (NCBI)	4200
RRID	AB_2879813
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P23368
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ME2(malic enzyme 2) is also named as NAD-ME and belongs to the malic enzymes family. ME1, ME2 are important for NADPH production, lipogenesis and glutamine metabolism, but ME2 has a more profound effect. ME2 is a genome-coded mitochondrial enzyme that converts malate to pyruvate and is involved in neuronal synthesis of the neurotransmitter γ-aminobutyric acid (GABA)(PMID:15532013). This protein has 2 isoforms produced by alternative splicing with the MW of 65 kDa and 54 kDa.

Protocols

Product Specific Protocols
IHC protocol for ME2 antibody 24944-1-AP	Download protocol
IP protocol for ME2 antibody 24944-1-AP	Download protocol
WB protocol for ME2 antibody 24944-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB	Adv Sci (Weinh) SUCLG2 Regulates Mitochondrial Dysfunction through Succinylation in Lung Adenocarcinoma Authors - Qifan Hu View Article
human	WB	Cell Res cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions. Authors - Linchong Sun View Article
human	WB,IP	Nat Commun AKT1 phosphorylation of cytoplasmic ME2 induces a metabolic switch to glycolysis for tumorigenesis Authors - Taiqi Chen View Article
Human		Metabolites Differential Inhibition of Anaplerotic Pyruvate Carboxylation and Glutaminolysis-Fueled Anabolism Underlies Distinct Toxicity of Selenium Agents in Human Lung Cancer Authors - Teresa W-M Fan View Article
human	WB	bioRxiv Glutamine supports human cytomegalovirus induced lipidome remodeling through reductive carboxylation. Authors - Rebekah L. Mokry View Article
		Free Radic Biol Med SIRT5 desuccinylates ME2 to suppress oxidative stress in bovine mammary epithelial cells. Authors - Shiang Sun View Article