×
Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

METTL3 Polyclonal antibody

METTL3 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 15073-1-AP
Publications(672)
Reviews (11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey and More (6)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, RIP, IP-MS, ELISA, CUT&Tag

Synonyms

EC:2.1.1.348, hMETTL3, Methyltransferase-like protein 3, MT A70, MTA70

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of various lysates using METTL3 Polyclonal antibody (15073-1-AP)

    WB analysis using 15073-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 15073-1-AP (METTL3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HeLa cells using METTL3 Polyclonal antibody (15073-1-AP)

    WB analysis of HeLa using 15073-1-AP

    WB result of METTL3 antibody (15073-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-METTL3 transfected HeLa cells.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of various lysates using METTL3 Polyclonal antibody (15073-1-AP)

    WB analysis using 15073-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 15073-1-AP (METTL3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of various lysates using METTL3 Polyclonal antibody (15073-1-AP)

    WB analysis using 15073-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 15073-1-AP (METTL3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of various lysates using METTL3 Polyclonal antibody (15073-1-AP)

    WB analysis using 15073-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 15073-1-AP (METTL3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunoprecipitation (IP) experiment of HEK-293 cells using METTL3 Polyclonal antibody (15073-1-AP)

    IP experiment of HEK-293 using 15073-1-AP

    IP result of anti-METTL3 (IP:15073-1-AP, 4ug; Detection:15073-1-AP 1:4000) with HEK-293 cells lysate 1800 ug.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human renal cell carcinoma tissue using METTL3 Polyclonal antibody (15073-1-AP)

    IHC staining of human renal cell carcinoma using 15073-1-AP

    Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 15073-1-AP (METTL3 antibody) at dilution of 1:1500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human lung cancer tissue using METTL3 Polyclonal antibody (15073-1-AP)

    IHC staining of human lung cancer using 15073-1-AP

    Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 15073-1-AP (METTL3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human renal cell carcinoma tissue using METTL3 Polyclonal antibody (15073-1-AP)

    IHC staining of human renal cell carcinoma using 15073-1-AP

    Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 15073-1-AP (METTL3 antibody) at dilution of 1:1500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human lung cancer tissue using METTL3 Polyclonal antibody (15073-1-AP)

    IHC staining of human lung cancer using 15073-1-AP

    Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 15073-1-AP (METTL3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of mouse testis tissue using METTL3 Polyclonal antibody (15073-1-AP)

    IF Staining of mouse testis using 15073-1-AP

    Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using METTL3 antibody (15073-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of mouse testis tissue using METTL3 Polyclonal antibody (15073-1-AP)

    IF Staining of mouse testis using 15073-1-AP

    Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using METTL3 antibody (15073-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of MCF-7 cells using METTL3 Polyclonal antibody (15073-1-AP)

    IF Staining of MCF-7 using 15073-1-AP

    Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using METTL3 antibody (15073-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, HT-1080 cells, mouse testis tissue, HepG2 cells, Jurkat cells, Neuro-2a cells, A549 cells, NCCIT cells, COS-7 cells, rat testis tissue
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman renal cell carcinoma tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse testis tissue
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:750-1:3000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15073-1-AP targets METTL3 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, RIP, IP-MS, ELISA, CUT&Tag applications and shows reactivity with human, mouse, rat, monkey samples.

Tested Reactivity human, mouse, rat, monkey
Cited Reactivityhuman, mouse, pig, canine, monkey, chicken, hamster, goat, drosophila
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7110

Product name: Recombinant human METTL3 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 229-580 aa of BC001650

Sequence: LNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL

Predict reactive species
Full Name methyltransferase like 3
Calculated Molecular Weight 64 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC001650
Gene Symbol METTL3
Gene ID (NCBI) 56339
RRIDAB_2142033
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ86U44
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

METTL3 is a key S-adenosyl-L-methionine-binding subunit, which is a component of a complex multicomponent enzyme that catalyzes the methylation of internal adenosine residues in eukaryotic mRNA, forming N6-methyladenosine. It contains 2 putative nuclear localization signals and 2 consensus methylation motifs. The calculated molecular weight of METTL3 is 64 kDa, but modified METTL3 is about 65-70 kDa.

Protocols

Product Specific Protocols
IF protocol for METTL3 antibody 15073-1-APDownload protocol
IHC protocol for METTL3 antibody 15073-1-APDownload protocol
IP protocol for METTL3 antibody 15073-1-APDownload protocol
WB protocol for METTL3 antibody 15073-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Nature

The RNA m6A reader YTHDC1 silences retrotransposons and guards ES cell identity.

Authors - Jiadong Liu
  • KO Validated
View Article
mouseWB

Nature

METTL3 regulates heterochromatin in mouse embryonic stem cells.

Authors - Wenqi Xu
  • KO Validated
View Article
humanWB

Nature

mRNA circularization by METTL3-eIF3h enhances translation and promotes oncogenesis.

Authors - Junho Choe
  • KD Validated
View Article
humanWB

Nature

N(6)-methyladenosine-dependent regulation of messenger RNA stability.

Authors - Wang Xiao X
  • KD Validated
View Article
humanWB

Mol Cancer

A positive feedback circuit driven by m6A-modified circular RNA facilitates colorectal cancer liver metastasis

Authors - Kaixuan Zeng
  • KD Validated
View Article
mouseWB,IF

Science

Stem cells. m6A mRNA methylation facilitates resolution of naïve pluripotency toward differentiation.

Authors - Shay Geula
  • KO Validated
View Article

Reviews

    4.9 out of 5
Add a review

11 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Mounika (Verified Customer) (12-25-2025)

Antibody is working good, bands are good

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:400

Vikas (Verified Customer) (12-23-2024)

Used for IB works very well.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK-293T

Tatyana (Verified Customer) (12-22-2024)

Worked well in WB (in 4% milk in TBST, ON incubation).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa and SH-SY5Y cells/human
METTL3 Antibody Western Blot validation (1:1000 dilution) in HeLa and SH-SY5Y cells/human (Cat no:15073-1-AP)

RASHMI (Verified Customer) (11-27-2024)

Good

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK-293

RASHMI (Verified Customer) (07-26-2024)

Used this product, highly recommended

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK-293

RASHMI (Verified Customer) (07-26-2024)

Used this product, highly recommended

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK-293

Fanpeng (Verified Customer) (03-14-2024)

This antibody works well in my WB and IHC/IF analysis using multiple cell lines and brain tissues.

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:2000 WB, 1:200 IHC/IF
  • Cell Tissue Type: human brain/mouse brain/rat brain/N2a/M17/BV2/primary mouse brain cells

PK (Verified Customer) (03-20-2023)

Good

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: AC16
METTL3 Antibody Western Blot validation (1000 dilution) in AC16 (Cat no:15073-1-AP)

Biao (Verified Customer) (12-23-2019)

This antibody is quite specific and gives strong signal.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: HCT-116

Shuliang (Verified Customer) (10-14-2019)

Good products

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: HEK293T cells
METTL3 Antibody Western Blot, validation (1:3000 dilution) in HEK293T cells (Cat no:15073-1-AP)

Mattia (Verified Customer) (08-26-2019)

Clear band at expected size. Multiple unspecific bands at lower Kda. 1:1000 primary antibody dilution, blocked in 5% milk. Primary incubated overnight.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa, HEK293T
||
New chat

Able™

正在加载，请稍候...