Tested Applications
| Positive WB detected in | mouse liver tissue |
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IF | See 1 publications below |
Product Information
24298-1-AP targets MFSD8 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18086 Product name: Recombinant human MFSD8 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 351-421 aa of BC029503 Sequence: FFILLPWGNQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSIEQAWCLYTPVIHLAQFLT Predict reactive species |
| Full Name | major facilitator superfamily domain containing 8 |
| Calculated Molecular Weight | 518 aa, 58 kDa |
| Observed Molecular Weight | 55-60 kDa |
| GenBank Accession Number | BC029503 |
| Gene Symbol | MFSD8 |
| Gene ID (NCBI) | 256471 |
| RRID | AB_2879481 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NHS3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MFSD8 antibody 24298-1-AP | Download protocol |
| WB protocol for MFSD8 antibody 24298-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Oral Sci Strontium-Alix interaction enhances exosomal miRNA selectively loading in synovial MSCs for temporomandibular joint osteoarthritis treatment | ||
Mol Biotechnol Non-targeted Metabolomics Reveals the Potential Role of MFSD8 in Metabolism in Human Endothelial Cells |





