Tested Applications
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25403-1-AP targets MGC39372 in IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21931 Product name: Recombinant human MGC39372 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-32 aa of BC025340 Sequence: MDSKDVEVSSIQVRRKPQHGVCSQLLGNYRCL Predict reactive species |
| Full Name | hypothetical protein MGC39372 |
| Calculated Molecular Weight | 32 aa, 4 kDa |
| GenBank Accession Number | BC025340 |
| Gene Symbol | MGC39372 |
| Gene ID (NCBI) | 221756 |
| RRID | AB_2880061 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MGC39372 antibody 25403-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



