MITF Polyclonal antibody

MITF Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA
Cat No. 13092-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

bHLHe32, Class E basic helix-loop-helix protein 32, MI, Microphthalmia-associated transcription factor, WS2A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, Jurkat cells, mouse heart tissue, rat skin tissue, NIH/3T3 cells
Positive IP detected inmouse heart tissue
Positive IHC detected inmouse skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13092-1-AP targets MITF in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3679

Product name: Recombinant human MITF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-91 aa of BC012503

Sequence: MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEFMKQ

Predict reactive species
Full Name microphthalmia-associated transcription factor
Calculated Molecular Weight 91 aa, 10 kDa, 59 kDa
Observed Molecular Weight 59-65 kDa
GenBank Accession NumberBC012503
Gene Symbol MITF
Gene ID (NCBI) 4286
RRIDAB_10597698
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75030
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The retinal pigment epithelium (RPE) has a essential role in maintaining visual function and dedifferentiation of RPE contributes to the pathophysiology of several ocular diseases[PMID: 22523078]. Microphthalmia-associated transcription factor (MITF) is a key regulator of RPE differentiation that is also down-regulated in dedifferentiated hfRPE cells. MITF is a basic helix-loop-helix (hHLH)-leucine zipper protein that involves in the development of various cell types, including neural crest-derived melanocytes and optic cup-derived retinal pigment epithelial cells [PMID: 10578055].

Protocols

Product Specific Protocols
FC protocol for MITF antibody 13092-1-APDownload protocol
IHC protocol for MITF antibody 13092-1-APDownload protocol
IP protocol for MITF antibody 13092-1-APDownload protocol
WB protocol for MITF antibody 13092-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cell Death Differ

Lysine methylation of PPP1CA by the methyltransferase SUV39H2 disrupts TFEB-dependent autophagy and promotes intervertebral disc degeneration

Authors - Huaizhen Liang
mouseWB

J Clin Invest

mTORC1 feedback to AKT modulates lysosomal biogenesis through MiT/TFE regulation.

Authors - Kaushal Asrani
mouseWB

Theranostics

TFE3, a potential therapeutic target for Spinal Cord Injury via augmenting autophagy flux and alleviating ER stress.

Authors - Kailiang Zhou
mouse,humanWB

Phytomedicine

Taxifolin inhibits melanoma proliferation/migration impeding USP18/Rac1/JNK/β-catenin oncogenic signaling

Authors - Libo Xu
mouse,humanWB

J Invest Dermatol

PMID: 23223141

Authors - Lee Chang Seok CS
humanWB

Pigment Cell Melanoma Res

D-tyrosine negatively regulates melanin synthesis by competitively inhibiting tyrosinase activity.

Authors - Jisu Park

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Eva (Verified Customer) (07-01-2025)

The antibody is functional both with and without antigen retrieval (AR: 110ºC for 1 min, a second cycle of 90ºC for 10s, in a citrate buffer 10mM pH=6); however, signal specificity appears reduced when antigen retrieval is applied, and its use is therefore not recommended. After x3 PBST (PBS + 0,2% Tween) washes, cryostat sample slides were incubated 2 hours with blocking buffer (PBST 0,2% + 5% FBS + 1% BSA) at Room Temperature (RT). The primary antibody was diluted 1:500 in Blocking Buffer and incubated with the samples overnight at 4 °C. Next day, wash x3 with PBST 0,2%, and incubate second antibody with fluorocrome at 1:500 2-3 hours at RT. Some background staining is observed, likely due to a high concentration of the secondary antibody, as it does not correspond to a specific signal. The staining is specifically localized in nuclei of pigmented cells, as expected, and no nonspecific signal is detected in other tissue types within the sample.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: iPS cell line differentiated into Retinal Organoids with Retinal Pigmented Epithelia Tissue
MITF Antibody Immunofluorescence validation (1:500 dilution) in iPS cell line differentiated into Retinal Organoids with Retinal Pigmented Epithelia Tissue (Cat no:13092-1-AP)
FH

Alessandro (Verified Customer) (11-06-2022)

no unspecific staining, great outcome

  • Applications: Immunofluorescence
Loading...
||
New chat Able
正在加载,请稍候...