Tested Applications
| Positive WB detected in | mouse kidney tissue, rat kidney tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human kidney tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15265-1-AP targets MLYCD in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7334 Product name: Recombinant human MLYCD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 103-454 aa of BC000286 Sequence: HHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEKNKITAAIFYSISLTQQGLQGVELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQTKEHGRNELFTDSECKEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPVANFHLQNGAVLWRINWMADVSLRGITGSCGLMANYRYFLEETGPNSTSYLGSKIIKASEQVLSLVAQFQKNSKL Predict reactive species |
| Full Name | malonyl-CoA decarboxylase |
| Calculated Molecular Weight | 55 kDa |
| Observed Molecular Weight | 50-60 kDa |
| GenBank Accession Number | BC000286 |
| Gene Symbol | MLYCD |
| Gene ID (NCBI) | 23417 |
| RRID | AB_2146403 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95822 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MLYCD, also named as MCD, is a 50-55 kDa protein. It is an enzyme that catalyzes the conversion of malonyl-CoA to acetyl-CoA. In the fatty acid biosynthesis MCD selectively removes malonyl-CoA and thus assures that methyl-malonyl-CoA is the only chain elongating substrate for fatty acid synthase and that fatty acids with multiple methyl side chains are produced. In peroxisomes it may be involved in degrading intraperoxisomal malonyl-CoA, which is generated by the peroxisomal beta-oxidation of odd chain-length dicarboxylic fatty acids. (PMID:12955715)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MLYCD antibody 15265-1-AP | Download protocol |
| IP protocol for MLYCD antibody 15265-1-AP | Download protocol |
| WB protocol for MLYCD antibody 15265-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MLYCD polyclonal antibody (Cat# 15265-1-AP) has accumulated 30 citations published in journals including Cancer Research, Hepatology, PNAS, Cell Reports, Genes & Development, Journal of Cell Biology, iScience, Laboratory Investigation, and Aging. The research fields encompass lipid metabolism and fatty acid oxidation, cardiovascular disease and heart failure, cancer biology, metabolic disorders such as NAFLD and obesity, and mitochondrial and peroxisomal biology.
| Species | Application | Title |
|---|---|---|
Cancer Res Malonyl-CoA Promotes Prostate Cancer Progression and Castration Resistance by Enhancing Lipogenesis and Ran Activation. | ||
Hepatology Acetyl-CoA carboxylase α promotion of glucose-mediated fatty acid synthesis enhances survival of hepatocellular carcinoma in mice and patients. | ||
Proc Natl Acad Sci U S A Ribosomal protein-Mdm2-p53 pathway coordinates nutrient stress with lipid metabolism by regulating MCD and promoting fatty acid oxidation. | ||
Phytother Res Administration of isoliquiritigenin prevents nonalcoholic fatty liver disease through a novel IQGAP2-CREB-SIRT1 axis. | ||
Cell Rep Acetyl-CoA carboxylase 1 is a suppressor of the adipocyte thermogenic program
| ||
Cell Rep Respiratory Phenomics across Multiple Models of Protein Hyperacylation in Cardiac Mitochondria Reveals a Marginal Impact on Bioenergetics. |
Reviews
What customers say
One reviewer reported a negative experience with this antibody for Western Blot on mouse liver tissue at a 1:500 dilution. They stated they did not observe the expected band around 55 kDa, giving the product a low rating of 1 out of 5. No other reviews are currently available for this catalog number.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hua (Verified Customer) (11-14-2024) | I did not see a band around 55 kDa on WB.
 |
