Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

MMP13 Polyclonal antibody

The mmp13 polyclonal antibody (18165-1-AP) is one of the most highly cited mmp13 antibodies in the market. It is suitable for WB, IHC, IF/ICC, IP, ELISA and has been referenced in over 829 publications.

Cat No. 18165-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

CLG3, Collagenase 3, EC:3.4.24.-, Matrix metalloproteinase 13, Matrix metalloproteinase-13

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells, MDA-MB-453s cells, mouse liver tissue, rat liver tissue, HepG2 cells
Positive IP detected inMCF-7 cells
Positive IHC detected inhuman liver tissue, human hepatocirrhosis tissue, mouse liver tissue, human liver cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18165-1-AP targets MMP13 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, zebrafish, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12653

Product name: Recombinant human MMP13 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 100-471 aa of BC074808

Sequence: DVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

Predict reactive species
Full Name matrix metallopeptidase 13
Calculated Molecular Weight 471 aa, 54 kDa
Observed Molecular Weight 65-70 kDa, 50-55 kDa, 40 kDa
GenBank Accession NumberBC074808
Gene Symbol MMP13
Gene ID (NCBI) 4322
RRIDAB_2144858
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP45452
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP-13(Matrix metalloproteinase-13), cleaves type I collagen and was previously thought to be the rodent analogue of human interstitial MMP-1. MMP-13 is found in hypertrophic and calcifying cartilage of mammalian growth plate. The bands seen with rat MMP-13 are consistent with a 59-kDa latent form and a 43-kDa active form reported for this enzyme, along with a smaller band at approximately 30 kDa(PMID:10771523). It also can be detected 3 bands that the glycosylated proMMP-13 (70 kDa), unglycosylated proform (55 kDa), and active MMP-13 enzyme (40kDa) by western blot(PMID:18332263).

Protocols

Product Specific Protocols
IF protocol for MMP13 antibody 18165-1-APDownload protocol
IHC protocol for MMP13 antibody 18165-1-APDownload protocol
IP protocol for MMP13 antibody 18165-1-APDownload protocol
WB protocol for MMP13 antibody 18165-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouse,humanIF

Nature

A plant-derived natural photosynthetic system for improving cell anabolism

Authors - Pengfei Chen
humanIF

Cell Stem Cell

A human organoid drug screen identifies α2-adrenergic receptor signaling as a therapeutic target for cartilage regeneration

Authors - Xiaocui Wei
ratIF

Bioact Mater

Synergizing adaptive immunity and regenerative signals to enhance osteochondral defects repair

Authors - Changjian Lin
mouse,humanWB,IF

Sci Transl Med

Single-cell atlas of human infrapatellar fat pad and synovium implicates APOE signaling in osteoarthritis pathology

Authors - Su'an Tang
mouseWB

Nat Commun

Osteocyte-derived extracellular vesicles mediate the bone-to-cartilage crosstalk and promote osteoarthritis progression

Authors - Na Liu
mouse,humanWB,IF

Adv Sci (Weinh)

Inflammatory Fibroblast-Like Synoviocyte-Derived Exosomes Aggravate Osteoarthritis via Enhancing Macrophage Glycolysis

Authors - Bin Liu

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Xie (Verified Customer) (05-13-2021)

Good IHC staining for Rat MMP13.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: rat knee joints
MMP13 Antibody Immunohistochemistry validation (1:100 dilution) in rat knee joints (Cat no:18165-1-AP)

Hongxue (Verified Customer) (01-12-2021)

clear wb band

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Liver
MMP13 Antibody Western Blot validation (1:1000 dilution) in Liver (Cat no:18165-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...