Tested Applications
| Positive WB detected in | HT-1080 cells, MCF-7 cells, U-87 MG cells, HepG2 cells, U-251 cells, J774A.1 cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human gliomas tissue, human placenta tissue, human prostate cancer tissue, human heart tissue, human oesophagus tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human placenta tissue |
| Positive IF/ICC detected in | HepG2 cells |
In sample preparation, the extracellular matrix needs to be included
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10373-2-AP targets MMP2 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, rabbit, monkey, chicken, goat, fish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0549 Product name: Recombinant human MMP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 461-660 aa of BC002576 Sequence: LGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC Predict reactive species |
| Full Name | matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) |
| Calculated Molecular Weight | 72 kDa |
| Observed Molecular Weight | 62-72 kDa |
| GenBank Accession Number | BC002576 |
| Gene Symbol | MMP2 |
| Gene ID (NCBI) | 4313 |
| RRID | AB_2250823 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08253 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MMP2, also named as CLG4A, Gelatinase Am, TBE-1 and PEX, belongs to the peptidase M10A family. It is ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. MMP2 contributes to myocardial oxidative stress by regulating the activity of GSK3beta. It cleaves GSK3beta in vitro. MMP2 can be cleaved into PEX chain(~60kd). Western blot analysis showed that the 72 kDa and 62/65 kDa proteinase activities were pro-MMP2 and the active enzyme, respectively (PMID:11112697,PMID: 30867536).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MMP2 antibody 10373-2-AP | Download protocol |
| IHC protocol for MMP2 antibody 10373-2-AP | Download protocol |
| IP protocol for MMP2 antibody 10373-2-AP | Download protocol |
| WB protocol for MMP2 antibody 10373-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-MMP2 antibody (Cat# 10373-2-AP) has accumulated 1,217 citations across high-impact journals including Nature Communications, Molecular Cancer, Cell Death & Disease, Theranostics, Journal of Experimental & Clinical Cancer Research, Advanced Science, Biomaterials, and Phytomedicine. Research fields span oncology (metastasis, EMT, tumor progression), cardiovascular disease (atherosclerosis, aortic aneurysm), fibrosis (hepatic, pulmonary), neurology, immunology, and biomaterials/tissue engineering.
| Species | Application | Title |
|---|---|---|
J Hematol Oncol Ilamycin C induces apoptosis and inhibits migration and invasion in triple-negative breast cancer by suppressing IL-6/STAT3 pathway. | ||
Mol Cancer MicroRNA-505 functions as a tumor suppressor in endometrial cancer by targeting TGF-α. | ||
Mol Cancer Alteration of tumor suppressor BMP5 in sporadic colorectal cancer: a genomic and transcriptomic profiling based study. | ||
Mol Cancer Role of the lncRNA ABHD11-AS1 in the tumorigenesis and progression of epithelial ovarian cancer through targeted regulation of RhoC. | ||
Mol Cancer Circ-AKT3 inhibits clear cell renal cell carcinoma metastasis via altering miR-296-3p/E-cadherin signals. | ||
Mol Cancer Down-regulation of miR-675-5p contributes to tumor progression and development by targeting pro-tumorigenic GPR55 in non-small cell lung cancer. |
Reviews
What customers say
Reviews are mixed. Two users rated it 5 stars: one found it highly specific for WB on glomerular endothelial cells with clean bands at the expected molecular weight, and another reported excellent IHC performance on mouse aorta sections for aneurysm studies. A third user gave 4 stars, noting it reacts to human MMP2 but not MMP9. However, two users gave 1 star—one observed no specific recognition on a mouse macrophage cell line (J774), and another reported many non-specific bands in liver tissue by WB. Overall, performance appears application- and species-dependent.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Monica (Verified Customer) (11-14-2025) | Nice MMP2 antibody for WB. Incubation was done for 1hr at RT. Gave bands at expected molecular weight and is very specific as MMP9 and MMP14 antibodies gave diffrent bands. Very pleased.
 |
Christine (Verified Customer) (07-11-2022) | it doesn't seem that the antibody recognized anything specific on this blot
 |
Hongxue (Verified Customer) (01-12-2021) | Not good for wb, lots of bands.
 |
Kyosuke (Verified Customer) (06-12-2019) | I am working on aneurysm study and use this on mouse aneurysm sectioning for IHC. It works very well.
|
Lucy (Verified Customer) (03-08-2019) | Reacts to human MMP2 but not human MMP9
 |
