Tested Applications
Positive WB detected in | A549 cells |
Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A549 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
16142-1-AP targets MRPL53 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9210 Product name: Recombinant human MRPL53 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC012163 Sequence: MAAALARLGLRPVKQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALEMLTAFASHIRARDAAGSGDKPGADTGR Predict reactive species |
Full Name | mitochondrial ribosomal protein L53 |
Calculated Molecular Weight | 112 aa, 12 kDa |
Observed Molecular Weight | 12 kDa |
GenBank Accession Number | BC012163 |
Gene Symbol | MRPL53 |
Gene ID (NCBI) | 116540 |
RRID | AB_2878223 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96EL3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MRPL53 antibody 16142-1-AP | Download protocol |
IHC protocol for MRPL53 antibody 16142-1-AP | Download protocol |
IF protocol for MRPL53 antibody 16142-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Rep A microscopy-based screen identifies cellular kinases modulating mitochondrial translation |