Filter:
Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 14 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
18881-1-AP targets MRPS17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13414 Product name: Recombinant human MRPS17 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-130 aa of BC054031 Sequence: MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ Predict reactive species |
| Full Name | mitochondrial ribosomal protein S17 |
| Calculated Molecular Weight | 130 aa, 15 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC054031 |
| Gene Symbol | MRPS17 |
| Gene ID (NCBI) | 51373 |
| RRID | AB_10597844 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y2R5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MRPS17 antibody 18881-1-AP | Download protocol |
| IHC protocol for MRPS17 antibody 18881-1-AP | Download protocol |
| WB protocol for MRPS17 antibody 18881-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell Identification of TMEM126A as OXA1L-interacting protein reveals cotranslational quality control in mitochondria | ||
Nucleic Acids Res METTL15 introduces N4-methylcytidine into human mitochondrial 12S rRNA and is required for mitoribosome biogenesis. | ||
Nucleic Acids Res Transcription-independent role for human mitochondrial RNA polymerase in mitochondrial ribosome biogenesis. | ||
PLoS Genet RCC1L (WBSCR16) isoforms coordinate mitochondrial ribosome assembly through their interaction with GTPases. | ||
RNA Biol TRMT2B is responsible for both tRNA and rRNA m5U-methylation in human mitochondria. |
