Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, Neuro-2a cells, C6 cells, mouse heart tissue, mouse lung tissue, rat heart tissue |
| Positive IHC detected in | human colon tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26053-1-AP targets Moesin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23531 Product name: Recombinant human MSN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 385-502 aa of BC017293 Sequence: EAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKD Predict reactive species |
| Full Name | moesin |
| Calculated Molecular Weight | 577 aa, 68 kDa |
| Observed Molecular Weight | 68-70 kDa |
| GenBank Accession Number | BC017293 |
| Gene Symbol | Moesin |
| Gene ID (NCBI) | 4478 |
| RRID | AB_2880353 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P26038 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Moesin belongs to the ezrin-radixin-moesin (ERM) family of proteins which act as cross-linkers between membrane and actin cytoskeleton. ERM proteins provide structural links to strengthen the cell cortex and facilitate several key cellular processes, including membrane dynamics, substrate adhesion, cell survival, cell adhesion, and motility. The function of ERM proteins is highly reliant on phosphorylation induced conformational changes in response to growth factor, chemokine, and antigen stimulation. This antibody may cross-react with ezrin or radixin with molecular weights around 68-70 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Moesin antibody 26053-1-AP | Download protocol |
| IHC protocol for Moesin antibody 26053-1-AP | Download protocol |
| WB protocol for Moesin antibody 26053-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Caitlin (Verified Customer) (09-10-2019) | Good Antibody for western blot
|















