Tested Applications
| Positive IHC detected in | mouse brain tissue, human brain tissue, human testis tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
12179-1-AP targets MT3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2823 Product name: Recombinant human MT3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC013081 Sequence: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ Predict reactive species |
| Full Name | metallothionein 3 |
| Calculated Molecular Weight | 68 aa, 7 kDa |
| GenBank Accession Number | BC013081 |
| Gene Symbol | MT3 |
| Gene ID (NCBI) | 4504 |
| RRID | AB_2146645 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P25713 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MT3(Metallothionein-3) is also names as GIF(Growth inhibitory factor),GIFB inhibits N-glycosylation of IgE-binding factors and that unglycosylated IgE-binding factors selectively suppressed IgE synthesis.The major cell source of GIF is antigen-specific suppressor T(Ts)cell(PMID:10967025).The molecular size of GIF from T cells is 15 kDa, while GIF from macrophages consisted of 40-and 15-kDa molecules(PMID:2417235).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MT3 antibody 12179-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biochem Biophys Res Commun Upregulation of p52-ZER6 (ZNF398) increases reactive oxygen species by suppressing metallothionein-3 in neuronal cells | ||
Int J Mol Sci Integrating Transcriptomics and Proteomics to Characterize the Intestinal Responses to Cadmium Exposure Using a Piglet Model |





































