Tested Applications
| Positive IP detected in | HEK-293T cells |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10235-1-AP targets MTCP1NB in IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0338 Product name: Recombinant human MTCP1NB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 6-68 aa of BC002600 Sequence: PCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK Predict reactive species |
| Full Name | mature T-cell proliferation 1 neighbor |
| Calculated Molecular Weight | 13 kDa, 8 kDa |
| Observed Molecular Weight | 8 kDa |
| GenBank Accession Number | BC002600 |
| Gene Symbol | MTCP1NB |
| Gene ID (NCBI) | 100272147 |
| RRID | AB_2189123 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P56277 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MTCP1NB, also named as C6.1B, MTCP1, MTCP1B, is a member of the CMC4 protein family. MTCP1NB is 8 kDa protein that localizes to mitochondria. MTCP1NB was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations(NCBI).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MTCP1NB antibody 10235-1-AP | Download protocol |
| IHC protocol for MTCP1NB antibody 10235-1-AP | Download protocol |
| IP protocol for MTCP1NB antibody 10235-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



